41 100 6561 http://exhibits.library.stonybrook.edu/mfp/files/original/818e800f767074b22b853efe40eaa9b5.pdf 27a82aa537ad4c4c1decd346d9c0b0c2 PDF Text Text mm—wmmWw—«Www 9w?” May Professor Dr. 9 22, 1976 Mitsuda Kitazono-cno, Shimogamo H. Sakyo~Ku 606 Kyoto Japan Dear Professor Mitsuda, It of you to send me the fine volume of the biological bases of metal illness, held in Kyote. I had heard much of the conference, not only the excellence of the papers and the discussion, but the generosity and hospitality of was kind 1973 conference on the hosts on Kyoto. psychiatry, is an interesting milestone in biological shall treasure it in my library. The volume and I I thank you for your thoughtfulness. Wm—n-m. < Sincerely yours, xwvwW w 9‘! aw," .. a. .,.... n..........,.7v.s... ,.. Nu .1. ~ pr... ‘. Fink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mitsuda, Hisatoshi Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-3-140 Date A point or period of time associated with an event in the lifecycle of the resource 1975 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9eace730d0cdc2a27605854f2ae5d13c.pdf c6ef5b233972797ddc7fb5aa74766fc1 PDF Text Text September 2, 1970 Dr. Shiroe Miura Department of Neuropsychiatry Tokyo Medical College Hospital 6u7-1 Nishishinjuku Shinjuku~ku, Tokyo, Japan Dear Dr. Miura: It of you to apply to work in this laboratory, you have obtained funds independently. As wrote, however, we are unable to accommodate any additional staff until our new facilities are completed in 1971 or early and it I was kind is useful that 1972. As plans I will see Dr. fully with more Kate in November, I him at that time. will discuss your Sincerely yours, Fink, ”.0. Professor of Psyohiatry Max MF:kt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Miura, Shiroe Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-8-450 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/97d7e134fa95faafd98b94e62b10b855.pdf 9ecfa0885be4bcaaed67935c4b071285 PDF Text Text March 5, 1965 Professor Iaioi Miuro Department of Houropsychistry Keio University 35 Shinanouaohi / Shinjuknvku ~ Tokyo. Japan Door Professor Hiora: Dr. Nsreski Hskomsra of Tokyo has roquestoo an appointusnt in this Department as a Research yellow. We have reviewed his curricula: vitae with interest. and ara writing to obtain further information regarding his pro~ tensions! ezperioooe and abilities. The programs in this Deportmsnt are primarily of a clinical neurophysiologioal nature. However, we are now in the process at developing animal oeurophysiologieal research laboratories. with specific emphasis on the effects of psychotropic compounds on_brsin function in dogs and other small Iniasla. we would be particularly interested in any comments you woulo like to make regarding Dr. Nakamura's ability to carry out independent research in clinical or experimental neurophysiology; his ahility to participate in collaborative research programs; and specifically. his technical ability in osurophyoioiogioal research with dogs or cats. we are particularly interested in the problem of implanted elaotrodas in chronic preparations. \ ‘ us would be particularly indebted for apaeific comments regarding Dr. Hakamura's ability in asintaining cogent conversations in Inglish and his ability to oom- annioato with his associates and assistants. Thank you vary mush tor your comments. Sincerely yours, rink. H.3m Profasaor of Psychiatry om: SAME & Keio Univ. Dr. Toshio Hera Director of Neurophysiological Lab. Dept. of leuropsychi. LETTER SENT TO: Dr. Kiyoshi Mdkita . Associate Prof. of Dept. Neuropsychiatry Keio University A 3 1‘ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Miura, Taiei Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-2-106 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4029f03b39ff7b7fe095c6de2cd0aa37.pdf 605b9fb7cd208e587684b7232a27918a PDF Text Text July 26, 1963 wxmnmm mnm.m Guam: Mirnmmmmnwmmmmdmattm Hm. tin 9f lutvinit :0 81:. Wis. At that tin WM Imwmmthntﬁamiﬁmlmwmmuofdunl quMimMmMmeminwim 'ﬁumdwmtmmdmudm‘tmmd Paymt date. mmwﬁnmwmmmdinwiudm. mmuthinmmsofthat. Ifthmismyfmqmﬁm' IWW‘.ma mimmm.ﬂdminthi;nm. Stanly yum. 1. . ‘-“ ‘m9- 153:1; {£2953 Max Fink, ﬂ. Dineth_ D. J.-.L'-_ A W mm ﬁrm: on: 655 W. 98th 5%. W11: 20. Him. A “Wadi-ALL”; � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mnemotron Corporation Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-358 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/30f6d558bc932a56f2c0d8b0a4df3323.pdf 6f4ff9e6f0aab22dafadd08cada22513 PDF Text Text March l2, 1968 Dr. waiter Modell, Editor Clinical Pharmacology and Therapeutics Professor of Pharmacology Cornell University Medical College l300 York ﬂew York. New York lOOZl Dear Dr. Model]: I am pleased to enclose an original and one xerox copy of our report "Behavioral and EEG Studies of Naloxone in Heroin Dependence" for your consideration for publication in Ctinieaz Phanmacotogy and Theaapeuzica. while this report describes our experiences with a small number of subjects, we believe the data to be of sufficient interest and timeliness. The studies cannot be extended because supplies of naloxone are not available at present. Thank you for your consideration. Sincerely yours, Fink, H.D. Professor of Psychiatry Max Mszp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Modell, Walter Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-1-047 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/cf0ea891fb29844f4f766cf8f18a58ca.pdf 4af694047e8ba094c99f2a0ab934d822 PDF Text Text April 30. 1968 Dr. Halter Modell, Editor Clinical Phanmacology and Therapeutics Cornell University Medical College l300 York Avenue New York, ﬂew York lOOZl Dear Dr. Hodell: is a revised copy of our report “Behavioral and Naloxone in Heroin Dependence.“ The suggestions of Studies and criticisms of the editors were very helpful and we have considered these comments and included our responses in this Enclosed EEG presentation. items were not incorporated. The question as to expenae of naloxone is unanswerable, since Endo Laboratories has consistently Two refused to provide a price. They have indicated that stated that expensive for naloxone from overseas sources and in this way make them. and have it was too they might try to obtain for future research. it available other reviewer asked whether the development of physical dependence on cyclazocine served a useful purpose in discouraging patients from deliberately missing doses of that drug. he also asked what is to prevent patients on chronic naloxone from omitting Your doses during periods when they plan to use heroin. Physical dependence to cyclazocine is minimal since the sudden cessation of treatment results in a withdrawal syndrome of a grippe-like nature. This is easily tolerated by patients. 80th the cyclazocine and naloxone subjects omit doses during periods when they plan to use heroin, but they learn to take their cyclazocine or naloxone soon thereafter and this maneuver seems to keep them from becoming readdicted. lead summary is provided. as suggested. Thank you very for your cooperation. A much Sincerely yours. Fink, M.D. Professor of Psychiatry Max Mszp ENC . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Modell, Walter Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-2-211 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/bc42dbdcfd967ad1e0558ee7f1770e1a.pdf 58a832da206d162718a414ef4654a7a5 PDF Text Text December 18, 1968 Dr. Walter Modell Department of Pharmacology Cornell University Medical College 1300 York Avenue New York, New York 10021 Dear Dr. ﬁodcllz Enclosed is a draft capy of "Electroencephalograms, Mental State and Psychotropic Drugs” for ”Pharmacology for Physicians". I am most grateful to Dr. Hollister and yourself for your kind invitation, and for his critique. Sincerely yours, Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Modell, Walter Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-6-556 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b6b69c11ebea4bd2c9f3d5ca3cb211f6.pdf 1868e37aa053bb1245d713516f2b0be1 PDF Text Text -..-wwnwrw—nvw—w—W—T—wwm—mrm.w.-W~WW—n_wm V—w«_r~___.—,v._.._,_.~._t April 28. v..___ -w__em. .V. . v..e.,e.-_r.q__ .______... ,V.___, fer. 1969 Dr. Walter Modell. Editor Pharmacology and Therapeutics Cornell University Medical College 1300 York Avenue New York, New York 10021 Clinical Dear Dr. Modell: Many thanks for the careful review and criticism of our report “Clinical Antidepressant Activity of Cyclazocine - A Narcotic Antagonist“. we have adopted the specific suggestions. which have materially improved the presentation. It is difficult to respond to comments of redundancy and our inadequacy. Redundancy has been reduced. but we are reporting the observations in two studies. with different populations, dosages. rating scales and personnel. For accuracy, we believe it necessary to report what we know and did. Any additional suggestions would be appreciated. Our inadequacies are well known to us. Cyclazocine is useful in treating opiate addiction. an illness with limited economic interest to the pharmaceutical industry. He suggested trials as an antidepressant based on our EEG criteria. They were met with indifference by the representatives of Sterlingwinthrop. Our initial trial was interesting to us but to no one else at NIHH or Sterling-Hinthrop. Recently. Schiele and Abuzzahab have undertaken a similar study. we carried out a second trial in a mental health clinic. Such 0P0 studies were new to me. and we found the drop-out rate high. At first we thought this related to cyclazocine, but we found similar drop-out rates with other drugs and populations in the same clinic. , V ,, w, 77‘-.._,._,,V,._ «WV, ﬂ ,, , , , �VFW—.WWWW “v" WW, ———.—..p -2- Dr. "Odell April 28, 1969 pilot study data. reported here. was sufficiently interesting for us to propose a direct. random assignment study against inipranine. But we could not support this stud . and while we vacillatad. the IND was withdrawn by To out a definitive study. would The Star ing-Hinthrop. carry require our own IND. new innds. 355, But. we believe cyclazocine to be as active . as imipraeine. Should this not be reported - an antidepressant somewhere, somehow? Incidentally. the naloxone studies have been re-instituted (in part because of the report published in OPT) and the pilot studies now include single daily dosages to 1500 age with antagonistic activity observed to l8 hours against 50 mg intravenous heroin. I do not know observations. It Thank you if CPT is still interested in the cyclazocine - without prejudice. if unacceptable. is enclosed for your consideration and patience. Sincerely yours. Fink. H.D. Professor of Psychiatry Max fokp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Modell, Walter Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-2-104 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a14a78c0c390a67b11c234d4ac6acb0f.pdf fef5b225a5e4c55f2f7851f7a4f28079 PDF Text Text n a- » ~ ~ - wan» ~ wvw~.v«-.va- .w March .- nwn—wmu . -. ~ 25, 1969 Dr. Walter Modell. Editor Pharmacology and Therapeutics Cornell University Medical College 1300 York Avenue New York, New York 10021 Clinical Dear Dr. Modell: I am pleased to enclose a draft copy of the report “Clinical Antidepressant Activity of Cyclazocine - A Narcotic Antagonist" for your consideration for publication in Clinical Phaamacology and Thenapeuzica. This report summarizes our experiences with cyclazocine in the treatment of depresSive illness an application which was suggested by our studies of its characteristic EEG effects. — studies were completed last year but I have withheld publication pending studies of this compound by other investigators. Reports of studies by others will These be presented at the meetings of the American Society of Clinical Pharmacology and Chemotherapy. Thank you for your consideration. Sincerely yours, Max Fink, M.D. Professor of Psychiatry MF:kp enc. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Modell, Walter Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-2-174 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f4693a70d80b87795a44d91124c292be.pdf a25162cad2a3abff0e27a565acd21ca7 PDF Text Text October 17, 1969 Dr. waiter Modell, Editor Pharmacology 3 Therapeutics Clinical Cornell University Medical College 1300 York Avenue York, New York 10021 New Dear Dr. Modell: I am pleased that our report "Clinical Antidepressant A Narcotic Antagonist” has been Activity of Cyclazocine accepted for publication. Page 12 necessary. if Enclosed Thank you Figure is an 1 and no abstract additional pages are as requested. for your consideration. Sincerely yours, Max Fink, M.D. Professor of Psychiatry MP :kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Modell, Walter Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-5-468 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4a9234c511eefac74d2fc202488a6d29.pdf f1865fd8fef55006afff23b9ffc124ac PDF Text Text .-.—" October 7, 1969 Dr. Walter Modell, Editor Pharmacology and Therapeutics Department of Pharmacology Clinical Cornell University Medical College 1300 York Avenue York, New York 10021 New Dear Dr. Modell: inquire as to the status of the report "Clinical Antidepressant Activity of Cyclazocine A Narcotic Antagoiist" resubmitted on May 1, 1969. May I Sincerely yours, Max Fink, M.D. Professor of Psychiatry MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Modell, Walter Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-5-482 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7bc1356da582c5110adee6421ab6114e.pdf f303735dbe6c5f80b66e29a38766f6d9 PDF Text Text December 18, 1968 Dr. Walter Modell Department of Pharmacology Cornell Univereity Hedicel College 1300 York Avenue York, New York 10021 New Deer Dr. Mbdell: Enclosed is e drett;£gy, og'"Electrooncophnlogrene, Mantel State and Peycholooiii’ rugs" for "Pharmacology for Physiciene". I en most grateful to Dr. Hollistor and yourself for your kind invitation, and for hie critique. Sincerely yours, Fink, M.D. Profeeeot of Psychiatry Hex � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Modell, Walter Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-6-545 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4c1a129b1152323ad0de9550112e872d.pdf 7f1e23e24a9928f7b77c48c8e4de5c66 PDF Text Text September 27, 1972 Walter Modell, H.D. Cornell University Medical College 1300 York Avenue New York City 10021 Dear Dr. Modell, Enclosed is a short report, Nalozone PUmoate:A*Long—Act£ng Opiate Antagoniat, for your consideration for Clinical Pharmacology and Therapeutics. This report represents our most recent effort in developing a useful narcotic antagonist therapy for opiate dependence. While the formulation has specific limitations, the data and the experience are of importance in demonstrating that extension of duration of action is feasible. I hope the logic is compelling, so that these efforts will continue to obtain support Thank you and interest. for your consideration. Sincerlly yours, Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Modell, Walter Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-4-310 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/fcbfd30eb0c341730ca4291fedaa789c.pdf 398f59f506d021e74344a9a4a4ed4840 PDF Text Text Fahruary 5. 196‘ m.'£{i€. ”Ohm Hananntn Chuntcnl Company 800 were! Lindbarnh Boulevata _ 8:. L031: 66.‘u1itouri Bun: Hr. “ant-nun: I au'urlting on bahalt a! the uiolourt Institutc of Paychtntty to obtain an uadnrstandiug haewica‘uounanna Chuuinal canpnay and thin Inatltntc.wtth rtgnxd ta n sweep mutt ituﬂiad £n£e1¢IXy-hy Br. a! psy¢hopharuncsuetaals which ﬁlluil Gatshca of anlbaurno. knuv,‘ar. Garthné joiuud an: seat! in Hatch of 1963. A. hit program. ht prtiuatad tbs clinical tasting of a variuty of unasaato eulpounda, snattully idtne£f1ad an the Evan tartan. Th3: prasrla was oi iatnrclt to tha Institute and. daring ch. lﬂlﬂﬂr, pravtntonal ptrutuston was given fa: uh. allntcul uniting a! that. eunpanndﬂ an out yapnlttiaa. Elan. than: 3305:: have not had tontctcy nuudtns, in tagunsttd that antunto carry thoao out at pravtéo fund: for tank. As you anu a! Br. anally not with an and Ladinatcd that Honnanuo was unahlu to ﬂurry an: ab: hunting at than. canpounds, not could thoy ptavté¢ innit. with yam: unacﬁrrcasn, tun court's ﬂush simulttnoanaly pur~ nutd.‘ Inquiriqa «it. lodgnd with varieua pharmacuutlenl ban... and a formal application (a: Inppotn van ﬂﬂdi to thn ﬁncianal Iattttutc: 91 31.3183. conunrtantly. yaw haw. rtaatvud a punietvo rup1y_£ron March of west Paint. Ina an haw! iota adviﬁod that ﬂan. lunﬁs will ha and: uvutlabla by an. Klulonal Institnets of annlth within thn not: thﬁtty ﬁiyt to: eaxietty stadiui. Butotu unsatitctug with pro—eltnlaal anxietcy Inborneorton sad eoa~ tinting this pwogrln, it is anaesatry that th- zalationmhip bctvu¢n Hannanto anﬂ ch; Mlasouxi Institutc of rny¢htutry, and pcrh‘pl ﬂhrck b. «tarifttd. WI manta ht grataful it you aauld nxrgngo to: such I clartftnntﬁan :3 scan as prnttieahlo. Sincnrcly yours, 1"“ Pink. an”. viructor � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mohram, H. W. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-1-110 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1825ab0a63134e19334cce50da1af85e.pdf c7bc46ab4dd0d31feaa52961afc9e2c0 PDF Text Text October 25th, 1972 Dr. and. lblitar, Lcndclh&nptutu&t Nanchan, Droncaborn$uncnatolln. 8000 thnhan 15, Goathastrtno 33. V. Govnnny. hour Death: Holitor. I an plcalod to unaxoae a eopy of the roprint you raquontod. Cyeltsocinc is ca uzpprt-ontal coupeund vhieh. at tho yruucnt ting. in availtblc through the Nationsl Institute of Mcntal Health. 5600 Fishers Lune. Roakvillo, Mhrylsnd 20852. or Sturllns Winthrop Roucnrch Institutc, Rensnalncr, H.Y. /~< Iran our ouacrlcnco 1t 1: clout that eyalgsoeinn 1. appliadhlo to Iarphinn .ddiction. heroin :ddictian and :11 0th.: opintc tddictioan. Good luck in your study! Biaocrely yours. ﬂux rink, H‘D. Profunaor or Pcyuhiutry ur/ia m. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Molitor, Med. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-4-281 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e81cc2d29d9b2c30051c714319a7ca33.pdf 27056ef92287d22a333af030ebc0e2d0 PDF Text Text June 7, 1965 In» thn Munroe Assistant Medical Director Squibb Institute fer Medical Research Brunswick, New Jersey New Ehar'Dr.!txwue: This past week and I discussed the long acting fann'of fluphennzine with Dr. Anthony Heueler, who was one of our caducmknre referred here. me He to you. recommended that I call Dr. Rizzo, who Recently, we believed we had fbund a number of subjects fbr'whnnathie long acting team of psydhotrqpic drugs might particularly helpful. we are writing to inquire whether this preparation is available, and if we could have a small be supply fbe'cmu*study purposes? 3 If the compound still is under FDA investigational use only. these laboratories are equipped to file the appropriate ferns ﬁor the study of this campound. I would appreciate having one of your representatives on my associate, Dr. Ali Keskiner, at these laboratories (MI 5-8230 Ext. 518). I call Thank you very much fbm~your eo-openetion. Sincerely yours. Fink, H. D. Professor of Psychiatry max HP:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-4-328 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8b94b83561038a6acde4ebb8d5fe4898.pdf 363f6222edfadb35f5849de4343e8bc4 PDF Text Text July 2, Join 1‘. 1965 Monroe, M.D. Amoiate radical Dhaator m Squibb Institute for Medical Research New Brxmmiok, New Jersey 08903 Daar Dr. Monroe: Myouforundingmtminfomﬁmmﬂupmzim and Dr. 11:11 amt-hate. My demons associates. ﬂuphamzim haw twinned this information m we are inclined to diamante. a trial with This immunim is hand on tha findings of Dr. Simpson, indicating ﬂat the «mate produces longer iwrovamt with femr sick struts. Is this Mansion justified by aﬂnr data and Dr. that chdmr you If mm nWir-n aimt lava? no, as mum be pleased to have you send us the proper classmate for our pm~ inmtigatiaml forms and supplies of liminuy trial. I will be available in St. Louis during the moth of July and look form to having you visit. Sinecmly yum, Pink, NJ). Professor- of Psychiatry 1%}: “Pump ,J‘W m: Dr. Ir. » - '1 'r- 'nxymr‘ u , ~.-. . s “:r‘ , K up: l-M-nwnrz-z" "r: )‘V' Itil Keskimr � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-5-399 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b78b61ffe5de5478ad7f69bcd768bbdd.pdf 94c09df93fb5a4a8f423537f33c72823 PDF Text Text Decanter 21, 1965 Dr. Jam 1“. Mmme Associate radical Directm Squibb Institute for Median]. Resend: m New Bnmewiac, New Jamey 08903 mm. "mm: We have mustered fluphenuine commute in eigxt patients. Webegmet Jocemweekbutsomheve «ministered up to 1 oo Moe weekly. In these patients, we have noted no water effects of this compound. There has been no rigidity, tremor, akethiaia, or other signs of Parkinson-aim. Widening the experiences made available to us, these observations seem mammal. I writing to 1mm if the made available to us has been studied betoh of elevation, and that the potenoy is «sued in experimoee elsewhere. Secondly, has this been ministered awn» safely once e ingomts week a ma of: mormmmdmmfmqumﬂym We have fund the clinical effects to be of great interest, but have been usable, so fer, to confirm the prolonged action for greater than one wok which had been reported by others. Iwmldbegmtefulifyouwouldoellmwrmymhevethe feats atyourfingertipo. Mxythamcs. Sincerely yours , Hex Pink, NJ). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-8-692 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/bd58cc0334ec37cb0025b486352bf3e8.pdf 2dddeafc27d576da94bdd7a6958c7692 PDF Text Text January 5, 1966 Dr. Jain P. Home. Maxim Medical Dimctm' The Squibb Institute for mama Research Welt. Barnum: New How Jenny 08803 Myron foryourphamcall this morning. Separately mmsmdingymtwoofﬂuvialaofﬂupmnazinenmin mmdmammdvm.u1t11mhurfrwyw,mwin mtinue to twat the patiesm following our meal with the of mi ﬂupimzim if the 011mm situatim wammts Edam *t. ‘ Sinmly yours , Max Pint, M.D. Professor cf Psychiatry MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-1-025 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/992dd1c3560a37a6cef2ffdb910b0d66.pdf c9deef630c788d8fa758239a71d387b7 PDF Text Text January 18 , 1966 Dr. John F. Mame Associate Medical Director the Squibb Institute for Medical Research New Brunswick, New Jersey 68903 Dear Dr. Monroe: vials of fluphenazine deomoate we are now putting it to use. very mob for your ooopemtim. The eighteen arrived safely and Thank you (25 lug/cc) Sincerely yours, Max Pink, ”.13. Professor of Psychiatry )4?sz P.S. Perhaps there is a}:1;)“ syringes a . between fluphmazine muse.intemotim Enclosed is me taken from the we � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-1-049 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/78814a306fbe82fcfade966d6379a818.pdf 9cb8ddd478429cfa1f649377dcfc3605 PDF Text Text 1‘is 7, fr. 1966 John P. Memos Associate radical Director Tm Squibb New Imtitute for Bnmmiok. New Medical Research Jersey 08903 marmm: First, letnetlwﬂcyoufortm informtimmgeming the potmcy of £3.me I indicated. our Me.Minimum of protocol allmd for the maitmt As pmoyclidim. This was done and was extremly effective in mdifying the motor effects of thymine. During tmmmweeks, sinoewehaveremcedtm Muslim. wehevemtedmincminsimeffectsmmeeppmnt clinical efficacy of the 001mm hes been Migxtened. Eleven patients are now in mutant, and ten additional subjects willbsentmdintothepmmmwithinﬁaemxttwoweeks I am writing today with regard to a different problem the past year. we haw developed a collaborative biting 15'slstisushi?”s with the Departmt of Psychiatry at the adversity of Istanbul in May. 'lhe Chairman: of tlwt Palm, is carrying out early thin W, clinicaldmgstudiosinthopopulatimssthismw‘ch 11". center and at the local amenity hospital, the Bakinmy. $lnsjustmittmtousﬂthMSWakenepamllel study with the fluphemzinc momma. It is my impression tut the decmte form has been pmdnoed since the mute may have had some pmblsms. Am the two forms clinically equivalent? If not, is fluphenazine (incarnate available in 'mrkey? What limitations using two different fame May? will be plum on our results if demote is not by available in Dostudiesofthisooepmndinﬁnopemmdertm of your office? jurisdiction Many thanks. Sincerely Hex hrsjeh Fink. yam. M.D. Professw of Psychiatry , � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-2-093 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/59b582c2a81399fd5c4cea3ff62f3e71.pdf fce9fd62b51b2ecbf28879856c446e67 PDF Text Text February 11, 1966 Br. John F. Home Aswciate Medical Director The Squibb New Institute for Mica]. Research Brunswick. New Jersey 08903 Dearth. Ham: In one of the subjects receiving film enmthate. whavejustdiaeovmdthatuheisinherthimmthof 811a had mivad a single dose of .Sac of flupinnapram. zine. Are there any contmindioatim to the continuum of this mutant? Sincerely yours. Max Hsznh Fink. 14.1). Profusor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-2-112 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d363acf0a6d1f818b7e3fba6c11be10f.pdf 186a073232ef75191d066f5319adf01c PDF Text Text March 17 , 1985 Dr. John P. W Institute far Meal Associate Medical Bimctor The Squibb New inick, Dear Dr. Kw Jamey 08903 Research Ham: yesterday mmhxgthe Imsmfulforyourdismim for our study in We Istmbul. I have writvenm Dr. Polvan mimingmp that he flupmine wiumﬁmymmmmsenmiw. Ihavcmgedhimtouse mmmlymithawihblewﬁatwebamatm cmbainpmllel. supplies of WMWMmhasmquimmll. Wehaveelem mmummmmntmmmaamminam mmmdﬂmmblymgjnmirmmtmm carlyinApril. “ additianl supplies of Wmmmfortm 1min. Mention, Simly yam, Max PM, 14.1). Professor- of Paydmiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-3-189 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d21d6d0a57afabc021944eee382eafee.pdf f21b7ee282b3a50154e37309017c40f0 PDF Text Text April 5. 1966 W. Jchn F. Harm Associm radical Dinetor Squibb Institute for Medical Ream}: m New new Jamey oasaa Wok. mm. Hmmez MahipmntsofﬂWMmmaimdmm. agohawnwbomputtomidwablem. Mmlspatimta mivinxthismdimtim.mdwmmmmindammtm pramt sypply will be daploted in thm m.airmail Rather than try- to mamas slumping at rates, wmnldyoukindlymdusminyaddiﬁmd lemmitaof Pmlizdn Diamante. lot no. At. 1-53/15-34. Many themes. Sinoemly youm, Fink, PM). Professor 9f Psychiatry Han 24?:ij . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-212 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7947246904a1ab6b7908260974dc06f0.pdf 824bd72f6d4563b322b92cfd72c759ac PDF Text Text �Ir. mum it In to have that I have to ear one-workers War in oi. the staff desigmted WW India. 31:. The imminent in this we” has been high and we are wondering if you would «cw-widen an additional atudy. For the past two years we have carried out an intensive. investigation of a may or therapy teaiatant peyomtiea. It was heoauee a manner ~«-mm~«.v wpv w“. w,— . amt failed to take their madioat‘lm that we the wolixin automate. more one approximately 16 patients in the discluzad gxoup from an! original atmly mmﬂon. of this group, the majority are meivlm butanerazim daily. We would wider the gradual transfer m (Wru-V‘wn-v-V‘V'P‘I'V‘F -, ﬂay 27. 1966 ~2~ 1 We and to eontimxe the many in order to provide newline inmtigatw mlnlamtion of .Pmlixz'm deoawate to ﬂame patients who already have mam? If so, mold you please wand he the eppeopriate fem ardiwlll mngetohave‘dmaimdarosuhmittedtoyou. I will, at that time, two over all the woollen of Pmlixin an rm .,-,-A,.,,.r—. ' ol'theaapatiemfmadailymleedleetiontemuxinonm thee mite-patient heels. and than to Mlixin deeamete, twofee lfeuohaatudywouldheefintemattcmlahmwiw. _Iaeplmadtotenmthatloanlethoeetwlinh clinical facilities for the evaluation of new We at me Metropolitan Hospital Center in New Yong. Thin facility is part of the Depwomt of Psychiatry at the New Medical College, and the We pen-dams” well as tin utwtlent Bowman: lam-I to the kind of irmetigatiom mice: we have in 3t. Louis. I look foamed to continuing my mlatimhip with 11m: and withmv. dame-{gm the new kind enough ka mum mum to call me last week Thank you ,vv . wee again foo your connotation. .......... ”a... _ Slowly in“... Fink, PhD. m Etofeesor of Psychiatry -W.,‘4W‘nM.-'l77“"17”—-‘.ar'7“I-"n<-."<P' .. ». m. mzjteh do: I‘m. A. J. Sameigne Mediate Medina]. 13.1mm» . Squibb New _ Institute fw Medical Wick. haw Jamey Research: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-307 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/828a3c54c947e9c750ef4f3df3cdc21d.pdf 710cabd5e581aeed452a94598433a3a4 PDF Text Text May 2'4 , 1971 Dr. Russell Memos Mmylmd Psydiiatzic Institute Baltirmre, Maryland 21201 momma, E‘. lu76 most interesting, emd by Domino , suggestive of a I found the discussions of as the evidence was presented potentially useful treatment of depression. I hope sate studies may be undertaken. editing an issue of Swim in I would appreciate the reprints EEG changes in patients with implmted of your reports of the electrodes. If you wish to publish these findings , I would be pleased to include this data. The reports are due by the end of June to meat om deadline. I neutimed, I Psydliatry dedicated to As My am ECT. best regards . Sincerely yours , Pink, 34.1). Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, Russell Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-5-332 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/45cebf0ff2a1abacc3b88362910d4acd.pdf 7acc6c357fa4ec6340e990f4d49f8407 PDF Text Text September 17, 1971 Dr. Russell Monroe University Hospital Baltimore, Maryland Dear Russ, letter. A combination of happenstances leads me to write this episodic states/alpha application for a study of me by NIMH for an 'outside' chloralose/EEG/psychopaths was sent to hear, there were some questions opinion. As you will undoubtedly and I believe Dr. by the committee about the EEG quantification, Your Shah will call you about this. the PRB-NIMH staff referred Dr. Michael in a similar Sheard of Yale University to me. He is interested behavioral EEG and problem, and plans to evaluate lithium, itsThe PRB sent him to effects, in psychopaths in a reformatory. systems to me for the possibility of using our quantification parallel to your own, and assist him. His studies are remarkably studies, I took the liberty of telling him of your planned He enquired as to suggesting that he contact you directly. EEG for classification, the availability of procedures to use the of activated EEG, and I was able to review the whole problem including your interest in alpha-chloralose. well trained; He is an interesting, bright, and apparently and you should find it interesting to meet him. David Paskeqitz. As part of my review, I read the report by he or you wish to visit us, it may be It is good, and should raises have been mutually helpful. Some of the issues hehave some data that could examined by my associates, and we may The same day, make your 7143;. 4"???" 31‘? My efforts easier and more rewarding. best regards. Sincerely yours, km“: . Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, Russell Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-7-469 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/635457f7283b3fa53747238e962b1cc5.pdf d6ebabfe00657b0bc2bb9469757e9aef PDF Text Text "mu...” “....r—‘— . u~.——'=.n—»v-——-..m—--w_ .va-WWHW- WWWW-m-.WT— .mu--.My g May m. .....m 'mﬁ'rw- “Feummnww—rw 3, 1976 Russell R. Monroe, M.D. 6H5 Redwood Street laltimore, Maryland 21201 Dear Russ, Your personal letter describing the opportunities at the Maryland Psychiatric Institute was most inviting and interesting. First, as to myself, for that was implied in the letter. I have no desire to head a laboratory center again, having had the experience in Missouri and finding that the administrative load kept me from the studies which I enjoyed more. best of The my students are recently placed in new positions. Jan Volavka, M.D. has just taken a position in Missouri, in my old center. Michael A. Taylor and Richard Abrams, both excellent researchers, have just agreed to go to the Chicago Medical School.’ The ones who may be movable and who come to mind are the following. Turan Itil has set up a large center in New York at the New York Medical College. But funding is quite difficult and if he could be assured of 'hard money', he may consider such a position. Recently, I met with Jerry Tintlenberg in Palo Alto. He researcher, but probably does not have enough experience to take Al Kurland's place. is a bright young Donald Klein has resigned from Hillside and has expected an appointment in the Albert Einstein College. But Ed Sachar may be moving, so he may be up in the air and may be interested in a lab with 'hard money'. These are the only three with whom I have had some personal contact during these past few months. I shall keep the opportunity in mind, and if another candidate comes to my attention, I will refer him (her) to you. My best regards and my thanks for thinking of me. Sincerely yours, Fink, M.D. Professor of Psychiatry Mal . ,._..-.. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, Russell R. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-3-144 Date A point or period of time associated with an event in the lifecycle of the resource 1975 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c1a178c8de3748a136b8786e6345eb22.pdf c5598cf0399314e85013a4a19a140485 PDF Text Text November 29, 1962 Mr. James W. Montgomery Librarian, Hillside Hospital P. O. Box 38 Glen Oaks. New York Dear James: Congratulations on your new appointment and I am delighted that you have the opportunity to develop the kind of library that you have wished for such a long time. Mrs. Matheson has worked very hard in developing our library and we are now in the process of expanding our stack epece to accommodate journals of many year‘s duration. In addition to the usual library functions, I have already begun a collaborative study with the scientists at Washington University in information retrieval. Next spring. when we have our Computer Center established. I trust that we will be able to undertake such studies and provide such information services as may be of interest to our scientists. Like all new ventures. this one has had its difficulties and developing staff has been a slow and tedious job. However, some very fine scientists are coming to join us this winter, and I am delighted because I anticipate an exciting future. Good luck on your new appointment. My best regards . Sincerely yours, MISSOURI INSTITUTE OF PSYCHIATRY Max Fink. M. D. Mfzaw Director Please address conspondenoe to: 5400 Arsenal St. , St. Louis 39. Mo. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Montgomery, James W. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-2-086 Date A point or period of time associated with an event in the lifecycle of the resource 1962 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/dec39f2892a2460b53161c8f13689d1a.pdf 57e5f8ec599f313f6dd8ae06b6ece2d3 PDF Text Text MISSOURI INSTITUTE OF PSYCHIATRY Shoo St. imam Street 15111! 39. ”0o Mr. James W. Montgmry Medical Librarion Army lot-and Neural Library Hillside Hospital P. O. Box 38 Elan Oaks, New York Dear Mr. Montgomry: I have now unpacked all my books 1nd hau._,oought the two have requested. I brought wither one with no and on you only recall that I road these earlier this you and ontioipato having rota-nod than to you. ‘ will be planed to know that I found some other that belong to you, homwr, and I am asking w librarian to paoktheaa and anuithamontoyouintho You books next. few days. are growing rapidly and I an very exalted about. library's future. Mrs. Mathem'n in worm very tall, we have already obtained an assistant for her. I look to having the library novad to the new building within next two moka. We have the and forward the mymxrnsxt trlptotm want, I shallbepleaoedto mviait as. m best regards, Sincerely yours, MISWD‘RI INSTITUTE OF Max 1*?me Fink, Director M. D. PmHIATRY � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Montgomery, James W. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-2-131 Date A point or period of time associated with an event in the lifecycle of the resource 1962 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/111aab3442b056fddd0cd3b7ce1d54dc.pdf a5ac2bf5521786232197e89423d2b70f PDF Text Text June 27, 1968 Jr., Director Narcotic Addiction Control Commission Mr. Louis E. Moon, Executive Park South Stuyvesant Plaza Albany, New York 12203 Dear Mr. Moon: The following is in answer to your inquiry of June 21, 1968. TR-34: This form is completed when a patient is admitted to Metropolitan Hospital for detoxification and additional treatment. TR—33: Completed when patient is either discharged against advice, or discontinues the aftercare program by not returning within a month of the date of visit or completes a period of inpatient and out-patient care and we have decided that no further treatment is necessary. Treatment completed implies that no other services in institution are deemed useful for the patient. Sincerely yours, Max Fink, M.D. Professor of Psychiatry HF:kp cc: Mr. Schwartz this � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Moon, Louis E. Jr Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-3-281 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0e0613a771d51cbd6820bf701a48f9b2.pdf 4d051f6254a3349abc24bd597123fc29 PDF Text Text Decenber 29, Mr. Dan 19:66 Tyler Moore Director Gems). and Board Chairman The International Platform Association 256“ Berkshire Road Cleveland Heights, Ohio tunes Dear Mr. Moore: It was kind Again, my of you to send me an invitation to join the International Platform Association. The description scans to indicate that the association recommends mmbors for lectures and that attmdance at an annual convention is the principal basis for association. I would be grateful for any further information which may be publically available mgarding the activities of the authors of the association and any publications which have recently been distributed in the name of the assooiation. thanks for your kind invitation. Sincerely yours, Fink, M. D. Professor of Psychiatry Max Mfzkp , � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Moore, Dan Tyler Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-8-560 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5f14c0606fbbe93c325f6333d3ba8c21.pdf 3f7a06cc4bcd03481ec81607bac2b8e8 PDF Text Text February 25, 1986 Mr. Steve Moore FDA Center for Drugs and Biologics (HFn—ZSO) 5600 Fishers Lane Rockville, Maryland 20857 ‘ Dear Mr. Moore, 1 became aware of the FDA Bioequivalence Workshop to consider the in vivo testing of pharmaceuticals on May 7-9, in reading the PMA of design Newsletter of February, 1986 (page 6). i have been testing psychotropics for their effects, on brain function using quantitative EEG measures for many years, and have carried out a numbq of bioequivalency studies. Lately, i was asked by the physicians at Hottmann La Roche Laboratories to consult on the issues of bioequivalence of generic formulations of diazepam with Valium. it is my understanding that these data led to a request by Hoffmann La Roche to the FDA to consider quantitative pheromone-EEG measures in the development of guidelines for bioequivalency of psychotropic drugs. ’ Will these questions be part of the discussion and presentation meetings? Would your ofﬁce send me a copy of the program? Many thanks. Sincerely yours, Max Fink, M.D. Professor of Psychiatry at the May � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Moore, Steve Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-030-8-255 Date A point or period of time associated with an event in the lifecycle of the resource 1986 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5aea610e4b6ae222d1fd4b2b42db9597.pdf 0ae1ee213fbe5d102469f3f89f0e55d5 PDF Text Text MarCh Hr. Joseph V. Moran 7 I4. 1968 ,« National Institute of Mental Health 5454 Wisconsin Avenue Chevy Chase. Maryland 20203 Dear Mr. Moran I am Re: MH—13358-02 and l3003-02 writing with regard to the restriction in international March 6. l968. travel in your letter of For many years, we have participated in the meetings of the GIMP - the principal international organization 9 devoted to psychopharmacological research. The next meeting is scheduled for April 24 - 27 in Tarragona.5pain. There are two presentations by members of this staff on that program. Funds for this travel are available in ”ii-13358 and 13003. like to send one representative of this program both to present reports. Curtailment of all travel would serious embarrass the organizers of this meeting and would He reflect would the integrdty of our commitments. We would be grateful if permission could be granted for one participant only instead of the two permitted for in these grants. on Thank you very much for your understanding. Sincerely yours. Mathink, M.D. Professor of Psychiatry Mszp - ' � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Moran, Joseph V. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-1-046 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e386e9ae3e0330eb67115c2fb1d1f109.pdf b67a1d98b86ace0fdbdc88ef02f9c05d PDF Text Text February 13, 1964 7 Dr. D. ﬂoriarity Worccutor State 30:91:81 Hotcoseer. Haanaehulctt: Dun: Dr. Motiirity: at Pakistan, ha- nppliad to tho-e laboratarics for thc position of a rctearch pnycbiatrilt, :nd has indicated you :3 a rcfgrcnco. Dr. Viola: Sunder Dan, I would be grateful fax any information that you may be able to give an regarding Dr. 03" training, raw snatch abiliciut, and interests. Theta laboratories have placed an «aphasia on clinical psychiatric reteurch. and I would bu most intaroatod in Dr. Dal' ability to communicate in a pragrau with our psychiatric papulution. Thank yau vary much for year cacporation. Sincerely yours, Nu: Fink. H.D. -Diteecot mm: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Moriarity, D. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-1-120 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c76cc278b4efaa3aa80f134d6eba2845.pdf b0190ed7c91b2cf7e60ef8b9a5700c7c PDF Text Text November 8, 1971 Miss Frances Morrall Chronic Disease Management 801 Second Avenue New York, New York 10017 Dear Miss Morrall: and I letter of July 9 was misplaced in my regret not having answered it when received. Your files, I am taking the occasion to enclose the report you requested, and some background information, should you still wish to use them. Sincerely yours, Fink, M.D. Professor of Psychiatry Max MF:ig Enc. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morrall, Frances Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-8-507 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/04ad06be27c1e4280c4982ec58b3c9c9.pdf 87efa60ee90cb7b893f300f6bb3ab104 PDF Text Text 7488*05983 6 ¥obruary 1974 Dr. Victor Toichnor Dopaxtuont of Psychiatry Hotropoliton Hospital 97th Strooc and 2nd Avonnc Nov York, Now York 10029 Door Dr. Toiohnar: I have known Dr. Alvin Bronson both acudonto at How since 1942, York Univoroity. ' whoa no were During the past two years. he has boon working in the nar~ cocic addiction unit of tho Department of Psychiatry at New York Modioal 001103.. Dr. Cronaoo in a oophiatioatod and careful psychiatrist with exocllont training and oat-asivo oxporiooce. Ho aocopted the challenge of working with narcotic addicts and hot done a oomnondablo job. I would recommond him plying without rcncrvation. for tho position for which Is is ap» Sincoroly yours. Pink. M.D. Profeaaor of Poyohiatry Max MF/ois � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morris, Robert W. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-5-379 Date A point or period of time associated with an event in the lifecycle of the resource 1974 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/34e30f4939c8226b256b0e4c78b52c75.pdf 28e5a820343cd1e9eb44a11f850bf6ec PDF Text Text Ebbruany Mm . a, 1966 Elsa Marxism mecmwsthesia W111: Hewletthaokm Many Box 301 Lowland. Colorado Mfummsms Wyoumrymmhformbmdxmmdbibnogmphym Electmsﬂmsia whidmyoumcently sent to me. 'Ihemama mafmfemmesmiahmofspecmintmattousand mldbemlpfulindaddingmthwmrsmdiaswiththia irammntmmbomdertmn. Hmeaeminymmfiles, Weapiesoouldbemdeavaﬂabletothishbamtory? W Citatiam 5, 10 and 36 are primary Citations 27, an, us, 65, so, 87, 95, 103 and $.th . for our interest. 193 are of special mampar-ticularly mmgitatim, in the prolonged effects, if any, on the electro1mm «naphtha-an. Asyouamnote mm: you for your assistmaa. 31:103me yam , Max Fink, M.D. Professor of Psyd‘datry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morrison, Elsa Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-2-096 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/782f5fe83eab7e22a9a495cfb9d63f3c.pdf 908c371e85d4c52048b9e41d32dd92cf PDF Text Text September 18, 1968 Dr. Lester M. Morrison Institute for Arteriosclerosis Research 9331 venice Blvd. Culver City, California 90230 Dear Dr. MOrrison: Thank you very much for your kind remarks regarding our studies of fluphenazine decanoate. You will be pleased to that we have just completed another study comparing fluphenazine decanoate and the commercially available fluphenazine enanthate. The differences between the two compounds are small and they are sufficiently similar for the enanthato to replace know the decanoate. sure that the physicians at the U.C.L.A. Medical of fluphenazine enanthate and would be in a make the appropriate decioion on behalf of your position to I am Center know patient. Sincerely yours, Fink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morrison, Lester M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-5-491 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f7dc7d606f77bf8c57d5a201cd5e24e6.pdf ac0d2df188e6f73891f3db458c006b77 PDF Text Text September 18, 1968 Dr. Lester M. Morrison Institute for Arteriosclerosis Research 9331 Venice Blvd. Culver City, California 90230 Dear Dr. Mbrrison: Thank you very much for your kind remarks regarding our studies of fluphenazine decanoate. You will be pleased to know that we have just completed another study comparing fluphenazine decanoate and the commercially available fluphenazine ensnthate. The differences between the two compounds are small and they are sufficiently similar for the enanthate to replace the decanoete. I am sure that the physicians at the U.C.L.A. Medical Center know of fluphenazine enanthate and would be in a position to make the appropriate decision on behalf of your patient. Sincerely yours, Mex Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morrison, Lester M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-5-506 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/bf4db9de09c4417812cdce18efbb2900.pdf ed911aa09d479a769f06497b0a00489b PDF Text Text August 20, l968 Felix Morrow l0 Old Colony Lane Mr. Great Neck, Dear New York Felix, pleased to enclose a copy of an outline of a called either "Lectures in Psychopharmacology“, "Psychopharmecology. A Neurophysiologic View" or just "Psychopharmacology." In addition I am enclosing two reports which form the basis of two of the chapters. A third report is enclosed to give you a view of the general field. I am volume to be I would be grateful proper way to present in My for your suggestions regarding the writing such a volume. best regards. Sincerely yours. Fink, M.D. Professor of Psychiatry Mex Mszp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morrow, Felix Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-4-346 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8ce4bd0befa9d6530397891d9964440b.pdf c97c1dd9400074b256204b5d3d514c9c PDF Text Text .-":'WI.1:‘~"~N'WHEW‘VU.7$"‘J‘6W~' -.~r~\'r.v-u.— sow-.71.... 'w‘“§¢-}4u:: V mar-aurmr 7 T _ July 7, V _ u.- mm -:~vw~.w~mwawwx~uwnw~ 1957 Mrs. Joan F’ior'rm National Institute of Mental Health Barlm Miding susu Wisconsin Roan 9001 Chevy Chase, Maryland Dear Mrs. "u: Mm: 315‘) With regard -~.- 'W‘i'ymwmv v in project mm ' Re: 3vm~12567 to our request for the mallocation of fxmds dated April 7, I am writing to pmsent Mil—12567, 5-1 of the equipment mqmsted. Desk IBM Calculator 8 1,700.00 1:95.00 Ebcemtary m Selectrio Wter Desks and Chairs 1:20.00 1,230.00 Assorted waste-paper 155.00 baskets, oostmmm and other office oquigrent $ 1%,000.00 'mank you very max for your assistance. Sincerely yotrcs, Fink, NJ). Professor of Psydziatry Max MF:kp v» in, ,«2 r w.”1» VW7,.:mt,u.ww," 1... -,, u...“w?- � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morrow, Jean Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-021-6-373 Date A point or period of time associated with an event in the lifecycle of the resource 1967 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/735393e994baf4b2ddb44a0f250b8933.pdf 92981d2fc26019a62cf52f1ef7f7ae09 PDF Text Text May 23, 1963 Dr. Mary Hbrnow Dupartmnnt of’Mnntal Health Khntucky Home Frankfurt, Kentucky Dear Dr. Manama: It was nice Both Dr. Energy visit chatting with you an the phone. Ulatt and I will beyuatewday pleased to have you us Friday, June 1%, 1963. que you have a pleasant trip. Sincarely yours. Max Fink, anoahar M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morrow, Mary Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-5-264 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/53348a8c88fc98ddff337ce0ea3be68e.pdf ed06a94ea98d149abd2acf300f083096 PDF Text Text J1me 12 . 1963 Dnmryﬂorrw 3016 Dogwood Drive Louisville, marlin Kentucky Morrow: ﬂankymverymchforyowletmrome within wider 9th.. Hamid the oamr maibe pleased to your application is that approval for three dency program. Baum, American Board of Psychiatry and Momma yam credit from the such Appoinmmt. As soon as you have is pnemquisite to such mtification, please sand tan a copy and sunnit the Miami Application Form which you took with you when you visited us. It will not it many mind to write the sworintondont of the this with him and it will be poomicationa go through this office. be necessary have discussed hospital, as I sible to have all Sinaemly yours, Max mm, Director Mszr M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morrow, Mary Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-303 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/ca2d72a517ed3283ff86d2c8210a99d8.pdf cda852fdbef5aa425c71ec199d0f10fd PDF Text Text “,7 w“...-_~,-hwm1ww.w—wn—mqv” - My 9.19” mm WNW momma. mm no. 393.5 mm. Horton: Mmtwwhtmrandupplmﬂon. Ila-wow Mﬁmw.mmmdmpmmmm6m w uawmmtmgwhmfwammmotm minithi utmlmloftthmminin.atm Manhunt-12mm. W. , Wm W1 mimmmmtutmmminmﬂnt Ithmmionmtyou paymiutrio axiom. ‘ PW“ Wartime; inﬁrm mm.mwmmm Wmmmmmmmummummam Inthia youuinbamwiudby~ “1%,.thm: mmwmuammuummmm www.mmluhwwmﬂmmummmt wmmmthatmtiupmuin.ommmolm your; and, cm: o 4 inputiunt thumpiaa and mmmmmwwmxmw hmmmamwmgypm.mm mmmmzpiammmmu atﬂiahoapim. WI. methatyour Wmmyoumiuipam Moro amoeba Itiamimmiontoumma mmmitzé‘wmu swammm. timinﬁutmwinbumd mmwmmmm.mmm �mummwu "mm-War a». any n m «a. July 9, 1m —m—-—w . heinmminmg www.mmwm mm.“ w itmmmmmmmm Mmumm mwmmmormamm WWW Wmmwmmmm.m WnnwmmWWmWata wmwswmuimmy. Immmmmtmymwmmm wanna” WMWWW 81mly ms. mar War Watt M0 bee: Dr. Innis 8. Dr. W 11‘. A. 1'. A. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morrow, Mary Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-338 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/baaa116ed06c6437a6c32b9c2614018f.pdf 2803730d41116d728bd7145ef7134f76 PDF Text Text " “WW5!- "Wm-v ..w..._.,..- v .. . . m-V’m~w‘m-‘:«T~1r~v ...... - ‘ w a“. ~ w‘ ~-~-\-v- u--. --- ;V'*~."' urn: wr-wu‘rva I‘q-irer- rwa-nw.wnx>_x ~a- - w...» '>~-:1~‘::Y:I'i-Ivmu..--I~Vnnw‘a-WNI March 1, 1971 Mr. Alan Morton Contributing Editor Business Wehk 330 West 42nd New Street York, New York 10056 Dear Mr. Morton: I read the report, “Fighting Drug Addiction with Drugs“ Week with interest and wish to commend your report. Easiness in It states most of the facts clearly and should be most useful to your readers. r)“ “—112. War "WWW-Civt-Igz'mm'm Wmm' Two notes near the end of the report may be overly optimistic. Our studies of £~alpha~acetylmethadol fail to support the interest of Dr. Jaffe. The drug is more complex to use than methadone and provides no long-term solution. We have already transferred a number of patients from methadone to cyclazocine, as Dr. Kissin suggests. Unfortunately, again, the two compounds are incompatible and the switch-over is difficult. Progress, although slow, is continuing, and if your report stimulates additional interest, as I believe it will, it will contribute to the solution of a serious problem. Thank you for your interest and a well written report. Sincerely yours, Fink, M.D. Professor of Psychiatry Max A rq— "r rm nun-r, W rmxm Tww-mw- Mszpt "mm � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morton, Alan Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-3-252 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f6c5dca310629ffb8159cb14db55365e.pdf 59d1884dbdd8da0872b78ff5ac8335df PDF Text Text March 1, 1971 g Mr. Alan Morton Contributing Editor Business Hehk 330 West 42nd New Street York, New York 10036 Dear Mr. Morton: I read the report, "Fighting in Business It states Week with most of the your readers. Drug Addiction with Drugs" and wish to commend your report. clearly and should be most useful to interest facts Two notes near the end of the report may be overly Optimistic. Our studies of £-alpha—acetylmethadol fail to support the interest of Dr. Jaffe. The drug is more complex to use then methadone and provides no long-term solution. We have already transferred a number of patients from methadone to cyclazocine, as Dr. Kissin suggests. Unfortunately, again, the two compounds are incompatible and the switch-over is difficult. Pregress, although slow, is continuing, stimulates additional interest, as I believe to the solution of a serious problem. Thank a well written report. it and if your you will, it report will contribute for your interest Sincerely yours, Max Fink, M.D. Professor of Psychiatry Mszpt and � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Morton, Alan Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-3-263 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/80e2b266d8fc4117bea4346b569ce065.pdf c36ae5116c37c97840bc1ef3f78d8538 PDF Text Text member 23, 1963 Professor 6. Momzzi Institute of Physiology Via S. Zeno 11-43 Pisa. Italy DearDr.Homzzi:, I amwritingat the suggestion of I'm. G. Siam ofthe Department of Antony of the {limit}; of Havana, Spain. who has applied for a position at the Missouri Institute of Psydmiatry. Dr. Sierra has indicated that he would like to join the Institute in the position of a Research Scientist in. Nwmphysiology. Institute has an active clinical Inseam program. and has developed laboratories in electroenoaplmlography. oanputer sciences, pmmuoolow, and psychology. At the present time, more is no program in ewimantal mmphysiolow mtsida of clinical monarch prom. The wateful for yam remndatim regarding Dr. suggestions regarding his ability to maintain an independent reI would be Siam, his personality. his ability as a researcher and especially any search program. Thank you my m foryour mWim. Sinoemly ywr's , Max Fink, Dimotor H. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Moruzzi, G. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-9-649 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b60801c3135804866467f0e1529a5cb5.pdf d99fd77daf4189f6980e8cf51160d451 PDF Text Text May 12, 1971 Dr. Loren Masher Head, Schizophrenia Research Clinical ResearCh Branch National Institute of Mental Health 5454 Wisconsin Chevy Chase, Maryland 20015 Dear Loren, It was good to meet you in Washington, and I was pleased to discuss the lactate studies which Drs. M. Taylor and R. Abrams are planning in these laboratories. I am enclosing a c0py of our initial summary, in which we confirmed the observations of Pitts and McClure. I hope the studies in Denmark are productive. Sincerely yours, Fink, M.D. Professor of Psychiatry Max Mszt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mosher, Loren Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-5-355 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f270c0318496dd8931a62797b250cfa0.pdf 84319d200568336c7d7813022678ac4a PDF Text Text mm 5400 Arum! Strut St. Louis 39, Minuet! Inner)! 8. 1963 ‘Mu. Ham Magi-mu . Hills!“ Hospital P. O. Box 38 Glen Oaks, Nam Ya“): 13m Ham: weeks ago Max approach“ a. to support your in position at mum. during the next six months Tho ambiguities A . that dwalopod airing in: minnow haw made it impouiblu far no to ice! that i «In at minimum airway in any of the midi“ going on in New York. 11mm written Max that 1 Mama“: and can only trust his )udqmcnt ta utilize the {was Mt by the government to the fullest extent indicated in the angina! grants . Bmo I am «mt am it till: man: you wanna! Manny. I shall do my but ta aroma you with 1mm: at rmmmmdaiion whieh my be nmamy to: you to find mothu position. In the want that the original analyst‘s an 1m pk“. 1 mid «ppm and rum“ you my aims your sending m minim data lawn. ‘ mm smelt-c1? vows, MISSOURI INSTITUTE OF PSYCHIATRY Max Pink. M. D. Director MP3)! � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mosquera, Hanna Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-4-163 Date A point or period of time associated with an event in the lifecycle of the resource 1962 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/2d7e4e441df96a681d1d001d6887a516.pdf 675e759419efd76866e0b5fcb4cf7d33 PDF Text Text May 16, 1963 Hum): Momma m. maids Hospital P. 0-. Box 38 man Oaks. Maw YOrk Dearfhmah: Mingmputfwdaysmmlmmmm malysisofmmmﬁamingthuanlmwiu— parts ofthcrmd. It mldbehelpful mmaiffomt tom.ifmomﬂddim¢thmou1tnofmstmﬂy. Would you and m auto-var infmtim you ham mlntad inmingdiffcmtludmubmtima? Simenly your... Mu Pink, H. D. ﬁrm: Dim i A, ’ ,,./" � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mosquera, Hanna Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-5-243 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/947b2e30ba3423e1ea67498cf561c03e.pdf a10751663a171a622f51b820c4ff9ae2 PDF Text Text Hatch 19. 1965 Dr. Frcdsrick A. Mote Psychology Building Univsrsity of Wisconsin Hsdison. Wisconsin 53706 Doc: Dr. Hate: Department for so liko to register so opening in thisHosting of April 29, 1965. cxpctincutsl psychologist, at tho Hiéwsstcrn an the accessory form for if you would send I would be grscoful available. and 1 copy of tho for-ml progrsn when it is I such would registration Sincorcly yours, Ms: Fink, MJD. Professor of Psychiatry number, APA ' � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mote, Frederick A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-2-139 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d63f36de79c4165ba798018be32ff607.pdf c8f0c92da0a9c9211c8d626b89772c28 PDF Text Text Summer 23, his. Joseph Mount 1963 - Western Data Processing center (IBM) University of Califomia 108 Angles Les Macias. at California Dear Joe: Since leaving Sm Jose two weeks ago. I have devoted mommmhalfmytimtomdemtandingﬂmtimscriesmodﬂ presented at the medical data woﬂcshop. Using Herb Jeoobs' {aromas a base. I have codified it to m on the 1620.. fortunately, e ample mWarienca takes 14/2 hw‘s ft» Un100 spectrum, ﬂutotaltim lagémwithﬂnedditimotam - hours 18 I madam! earlier, I plan to be in Sm Francisco 2 to October 9, and should likem oppommity to fly dam to UCLA and visit your shop. I have two opportmiﬁes, either on Friday evening. October It. or on Mucky or Nemesday. October BorOctobers. Ihavewzittsnalettertobeanm, soapy ofmichis enclosed. askinghimmtherhe wmld not vet ny visit. I chasm be grateful for an oppomﬁty to process sane Also, Ihewbuneskedbyttabimctw ofourdetemingmﬂ'. of the Water Center of Washington University. Mr. 81:31am As from October Modular, toteke almgatapeendtoaskmﬂmrm couldnot of at a m W21. Ishmﬂdeisoliketoaskformcmcuhitytoem smtimwimm.Jec0bs,ifmetcmbsax-xmged �my. Joseph 'Mmt Sepmm 2M, 1983 Page 1m IMdlihtosaymagaianthmjoyadm mainSanJoecwmmymmdymn-umhuamm fine mtntiom. My best regards. SW13; yours, M.Firﬂ< Mleg 1 m. cc: m. Dan 31mm 238 South Gala mivn Beverly Hills. Cranium � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mount, Joseph Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-7-451 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/774e937f16101429fb837bf5105a1dde.pdf 46b63af45fd8a75c80e32ced3e3e0502 PDF Text Text � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mowrer, Marie Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-3-341 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/bbb18a593a783008ed09d0fd78cf649c.pdf af7a075c381f1fce4db7ce5c11dbb8af PDF Text Text July 24, 1991 Honorable Daniel Moynihan U.S. Senate Washington, D.C. 20510 Dear Senator Moynihan, As a psychiatrist with more experience, I am writing with regard than 40 years of professional to the progressive deterioration in medical care in our nation. effects of the Great Society legislation been have not on medical care salutary, and the present considerations RBRVS HCFA fee schedules for Medicare for psychiatry will make of by matters considerably worse. The guidelines provide inadequate payment for practitioners for all psychiatric services to the elderly. Because these guidelines will become the standard for all insurers, the impact on psychiatric care throughout the nation will be negative. Psychiatrists have been among the less paid members of our profession, and instead of improving the availability of psychiatric treatment, the proposed regulations will make care even more limited The proposed than it is. Are you aware that various psychiatric treatments are not available in our State for the patients of the Office of Mental Health? For example, convulsive therapy is an effective and safe therapy (see NIH Consensus Conference report, 1985) which is available only in academic and private hospitals and the few academic affiliated hospitals of OMH. Under the present regulations, this effective treatment will be even less available. urge you to vote to eliminate the 50% copayment for psychiatric services, and to improve the proposed MFS for psychiatric I treatment. Thank you for your attention. Sincerely yours, Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Moynihan, Hon. Daniel Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-032-3-080 Date A point or period of time associated with an event in the lifecycle of the resource 1991 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8ef5ab7f56b3a46eaabf3248a2c5ae78.pdf e812bf305418a2a9e881e307b3177371 PDF Text Text MW" MONumbur Mr. 5, 1963 Gantnr Tektrmix, Inc. 5920 Nall Mission, Kansas Dark. 2A6). W: Thank you amplifiers. for the use of your Tektmnix 122's and Wuﬂdympleaaeatopbymdsoemmyéurmxt visittoSt. Louis? Simmly yours , Max Fink, Dimctw H. D, � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mr. Gantner Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-8-547 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/ebce77ae7d7ef5f1ad6a462f73657f35.pdf 6d0316b8b470505531a23b19fbe28434 PDF Text Text February 7, 1972 Dr. Stanley Muhler Office of Aviation Medicine AHrlOO Federal Aviation Administration mmmgm,mm Dear Dr. Muhler: City, invited the participation of our laboratory in a conference on cannabis in Oklahoma in June. When the invitation was discussed, we realized that a flight simulation task would be a most sensitive index of central nervous system effects. Indeed, the sensitivity of the driving sienlation has been demonstrated, and the additional planes of Dr. James Lewis, FAA. Oklahoma 'Im—v - reference of the flight simulator should exaggerate the sensitivity greatly. Are ,wvw.v.w‘m consideration? studies of cannabis on this task in progress, or under If not. would such studies be of interest? w, are involved in a variety of studies of cannabis in volunteers in the United States, and in chronic hashish users in Greece and Jeeaeca, West Indies. My personal interest is based on my recent licensing as a pilot, BEL. we Thank you for your reply. Sincerely yours. Fink, M.D. Professor of Psychiatry Max w- W's-v" “rm-ewe- ' m’oW‘W www- wwwx- MF:ig � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Muhler, Stanley Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-1-083 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/97f86a154c7bdefadfc21716ee5227a9.pdf 1cd0a0a8ec8ba95f5382c8b5a3ee5ff3 PDF Text Text December 16, 1971 Dr. S. J. Mule 80 Hansen Place Brooklyn, New York 11217 Dear Sol, Enclosed is my reiprt, EEG Henry Brill ETTEOts of’Drugs of’Dependbnoe, and yourself. I regret the extra volume edited by delay but I hope the data presented justifies the qeiting. I would be pleased to have your comments and suggestions for modifications, should these prove useful to the overall design of the volume. for the My best wishes for the volune's success, happy and healthy New Year. and for a Sincerely yours, Fink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mule, S. J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-9-555 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c5322d37bdabbfa70ce0278472c1faf9.pdf 6fb65aaff558b899d45db9e23735eef1 PDF Text Text April 17, 1971 Dr. S. NACC J. 80 Hanson Brooklyn, Mule, Ph.D. Place New York 11217 Dear Sam, Thank you, and Eenry, for thinking of me for your volume on drug dependence, particylarly for the electrophysiology. I am pleased to accept your invitation, with one caveat : the data will not be novel. Our data on heroin, methadone and the antagonists have been published; the cannabis is in press; and I know of no new material for barbiturates, cocaine, LSD, etc. If you still wish it, a chapter on of Dependence " can be prepared, as with citations. of Drugs Good luck ”The Electrophysiology an academic review ! Sincerely yours, Max Fink, M.D. Professor of Psychiatry mf/ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mule, S.J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-4-281 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/baec01ab67a7eb831760d7d2100951a3.pdf 80c753cd33c682ef3a3151035d23f748 PDF Text Text November 6, 1970 Dr. Samuel Mule 205 Arborley Aye. Mbrriaville, Pennsylvania 19067 Dear Sam, Enclosed is 200 mg £~alpha~acetylmnthadol establishing standards for urine testing. My for use in best regards. Sincerely yours, Fink, M.D. Professor of Psychiatry Max MF:kt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mule, Samuel Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-9-505 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4ff2a7f4aaa83abbd9f706c27d254c6c.pdf 1c6edf9886b98034ac2f371b84f78c3b PDF Text Text May 15 , 1967 Dr. K. Muller Department of Bleatzophyeiology Wial Allan Institute 1025 Pine Avenue West Montreal 2, Qlebec Canada Dear Dr. Muller: Thank you for your letter requesting information about the canputer analysis of evoked maponees. ﬁring the past few years, we have carriedrmt few studies with the evoked response, and in general have followed the descriptive method thatmoetworkemueeinevaluetimthewtputofﬁxeCAT oarputer. Porthismason, Idomttlﬁamtl‘atotmmﬂndeare of any special value to you. I may suggest, hcmever, that 5mm information regarding the analysis of evoked responses can best be obtained fm Dr. Charles Shagaes at Temple University in Philadelphia. Thank you for your interest. Sincerely yours, Fink, M.D. Professor of Psychiatry Max MFﬂcp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Muller, K. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-021-5-287 Date A point or period of time associated with an event in the lifecycle of the resource 1967 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/eaadc25bf7884d82aeb6bbb31fbfdfe5.pdf ebf10bbd02d4bf7c01f2dcb5b9694a5c PDF Text Text wt ——.—w»-‘Hw-v‘w < a w, _ .w—F ‘41'n’v‘w“ - w- —-. .vv v-mmr: w-v - ~ m?“ "mwlm mum‘umw-wwwr—www-a—'wmmu-er- --. . July 8. 1969 Dear Dr. Munch, ; g i A a. mam-1.1 V'W- 'H—nnrm" NV.- : ; 3 ; "x. mun-n =1- I very much appreciate the reports which you kindly sent me I have read with great interest. The material is of special interest, for if it presents the most salient date upon which criticism of cannabis use is based, then the criticism is indeed poorly founded. The two reports containing the most detailed cases, that of Milean and of and which Greenest, are the most convincing. Dr. Milecn's data is the most damaging, and cannot be easily faulted. Dr. Groseman's in week for the teeaon that a special type of American becomes an oxpetristed 'hippie‘ and then the use of anything aunt be assumed and the results can be ascribed to anything. hetero you conclude that our laboratory is a defender of cannabis use, please be assured that we are not. We have reviewed the available literature and concluded that there was insufficient evidence upon which to base any conclusion. and have pretence new extensive experieental and sociological studies, including some overseas in arena where potent cannabis in is use. with the authors who rail against cannabis use without date is that they play into the hands of the community leaders who wish to use such a movement £0: political purposes, and serve not to decrease the use of the dings, but to increase the distance between potential users and the rules of the establishment. we recall with great interest the sharp reduction in LsD use when acme of the fearful consequences were advertised. Not the general consequences of psychosis, but the specifics of genetic damage. Until such a connection can be found, if it indeed exists, the present ceiling against cannabis by articles purporting to demonstrate connection: will serve no useful purpose. In this I would include the articles by Glett, Leonard. Munch and Luby, 0‘ those that you sent me. Our argument I, too, will he at the and would be pleased Again, my to meet you meeting, at the addiction after theeseeaion. AHA thanks for your kindness in sending me ww- the reports. Sincerely yours, www"ﬂ'm‘l«~:>v Mex Fink, M.D. symposium, � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Munch Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-4-416 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f937243bc21072c196e2596b0c9c16c2.pdf 281fcc23de81455164f2e85891fe9d52 PDF Text Text beeswax? 2 , 1965 Messrs. E. mnksgaard W, 6 Nomgsds Denmark Gsntlom: Please send as the following EEG Supplmnt,ss advertisodinﬂnkigustnmsrofWEBGJomml," volume 19,1966. 'IHE BARBINRATE A CLINICAL AND 8111!”. M. Wagon, WC MI. W: Hem]. Wulff, Mileagaard, 1960.176 pages, 8%». 00. Murderou'dtobemcdbysubscribm toths journal for obtaining spacial rates was, mfommately, omitted when the separate numbers of volume 15 were hand. Remittance you may sud-1. for the supplant is enclosed. Sincsmly yours , Fink, H.D. m Executive Director Hfzkp mo. Thank � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Munksgaard, E. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-8-647 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/75cb1f18badc6b0661b9a7e66d5115ff.pdf 4047008125bcbac26fad528b9ead7c59 PDF Text Text timer 30. 196% Mrs; Helen W School of Social work ' ' waahingtm {trimmity St. mum 30, 9413an mm.mmx blemplemdtopmvidaanoppormityfor students to chum the Institute's anathema field and: 93 yea knew, sd‘mizophmnia in mlaﬁm to Wants. program 3933mm and the they have already attended We of our mat they will find these at am interest. Dr. I trust minwillvmakowmmmntaasfm timtotiamwbemmsuympwvidsymatudantswim a 8&meth emricnm. Sincerely yours, m M, PM). Dinetor mfgls marlin G. A. Ulst’c . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Murdoch, Helen Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-7-801 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0ad1cbf7043e65e4e25ffedcde25fe58.pdf 9841a206721c8e7ca2fd1ed79d6c814b PDF Text Text . V. w . va‘r‘w-VV” “7.... ~ --,'f—v-“—->vraevw1pvrnv 47‘ « Aﬂmuzmur-www w—w «was m-lrb'rm'tiwsan" W'mw: w r.-. may-"wan; m July 9, W M a“. mlvin ”muff Pom-It Park Ebro]. yaw-«m»,— ‘w'tl'wv" .w—ummAmuu-wmm— r .- "an..." -wW..n~vv-m “919 81:. www-qu .w—v—v“ n .ynm- l—W— - an .wwwrw 1966 Meal mm 00mm: min. nil-amt 63108 w. WI: Mmmw.mmmtmximtoukm mummmlmﬂminﬁummticmity mmmWathdeM-y {militia an mum hematovldtmmmlwz,wmmﬁnlutﬂm at Hospital Cult-r. Would ya: mam.uﬁnummmmmmtw Wmlm.wdmhmﬁthmm. ‘Ihmk you ‘ for your mm. Shmly yours, W‘mt m‘w'vﬁ'ﬂ Mu Fink, NJ). 9""u Professor of Psydxiatzy "F v~v-r Um' -Iﬂ"‘F"Il‘:lwr—rv 1""W‘w-wzﬂ-x :- /w<—,v.wv—.Wn-wqm r: -1 .n-ww-ﬂ-wr '1 . erkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Muroff, Melvin Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-384 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/efa8457427225d9c04a902eb3f929aaf.pdf a7c58fc2954e4f59dc064ba792080cad PDF Text Text January 18 , 1967 , Dr. Melvin Muroff l691.9 Buckingham Court St. Louis, Missouri 63130 Dear Mel, a scientific meeting last evening one of my friends of an article that appeared in the meant issue of Lock. (that containing the first installment of the Mmehester Book) which described the use of video tape in gulp therapy. The article describes the work of Ian Alger, a psychiatrist told At me this will interest you, since Imcallyoxmdiscussionoftreuseofsuchtepesinymm who I know in New York. Perhaps practice. My best regards and in calling me last many weekend. thanks for your Wtfulness Sincerely yours , Fink, M.D. Professor of Psychiatry Mex Mf‘ﬂcp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Muroff, Melvin Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-021-2-042 Date A point or period of time associated with an event in the lifecycle of the resource 1967 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/28aed725bd962e9157c7c69f4288d4bc.pdf 4773191698066e277d182eed7b8cfd80 PDF Text Text Danuary l, 1978 Melvin Muroff, Ph.D. l2 Harcourt Scarsdale , Road NY Ref: Hayden Harman, age Dear Mel, 8 Wwv-m-wrwv-mr wwm “war-war— m w vw-.mwm;.u.. Wu sum—7:»: I have read the (dated 12/6/77) of the patient, file and reviewed the Hayden Harman. EEG record The EEG record is well done and includes alert, photic and stimulation hyperventilation sections. These show mell modulated dominant alpha activity of relatively low voltage. Slow frequencies are not prominent, nor are they stimulated by hyperventilation in undue amounts. I concur in hhe report by Dr. Scheinberg that this record does not show any abnormality inconsistent with the patient's age. We should note, however, that an important part of the EEG capability was not used, that of sleep recording. Numerous authors, notably Gibbs and his students, have repeatedly emphasized thp significance of such recording particularly in young patients in whom one is seeking evidence of dysrhythmia. rest of the file is replete with evidence of cerebral dysfunction, particularly the report of the observations by Dr. Ballweg. These data, combined with the behavior and the reports in the psychological tests (see particularly the figure drawn by the child) are evidence of dysfunction. Unfortunatley, it is not possible to determine from these data whether the dysfunction is episodic. The most conservative approach to problems of this dimension is the conbined pharmacologic~psychologic. The former provides The an opportunity to alter one may be fortunate in cerebral functions, and with proper manipulation, affecting the functions favorably. Two courses are available: a trial of an anticonvulsant, such as diphenylhydantoin (Dialantin) in doses up to 300 mg/day; or a psychostimulant, either methylphenidate (Ritalin) or dextroamphetamine (Dexedrine). I favor the use of methylphenydate as it has a better safety margin. The use of these drugs should be combined with sessions with the child and on occasion, with the parents, to assist in the adjustments necessary in helping a child whose �mm [Jp— n... ‘vw “r Dr. Melvin Muroff ........ January 1, 1978 ............. page 2 ..mww.aw-nw.w<~wu, achievements may not be as good as his or his family's aspirations. If there is a choice in the sequence of drugs to be tried, would depend on the clinical findings as your best guide. Since you already have noted the similarity of this boy's problems to those seen in others helped by diphenylhydantoin, I would encourage its I trial first. If there is a special need to verify the possibility of dysrhythmia further, then a sleep EEG could be obtained. If the laboratory at Lawrence Hospital is reluctant to carry this out, I would suggest you enquire whether Dr. Fred Struve of the Hillside Hospital is willing to do the test for you. He is a Gibbs' student and one of the best analysts of clinical sleep EEG records in the region. The other is Dr. Eli Goldenson at the New York Neurological Institute. I trust these are helpful. for the success of this child'd treatment. comments My best wishes Sincerely yours, Fink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Muroff, Melvin Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-029-1-058 Date A point or period of time associated with an event in the lifecycle of the resource 1978 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d7d4531f52ed9c6bbf2790542b744fa0.pdf a81badd68d25f8a602a99b886983b204 PDF Text Text r_.——- » rwv—v' . nim’mm": ism-'- WW“ rl—IWP‘P w'mww'mxww‘ Wmaww-r—r-wum—vww 1:"v *-»-’-’ w , V _ , m‘rmw . WW..." v March 24, 1986 vm-:’.-.—_.m-., Henry B. Murphree, M.D. "‘Wlw-Jw, Department of Psychiatry Rutgers Medical School Piscataway, New Jersey 0885“ Dear Henry, am writing this letter in support of the promotion of Dr. Helen M. Pettinati to the rank of Adjunct Associate Professor at the Rutgers Medical School. I have known Helen for a few years, first becoming acquainted with her studies of ECT when she reported assessments of the differential effects of electrode location on the efficacy and side-effects of ECT, and the lack of effect of dexamethasone on ECT induced cognitive impairment. I Her work has been excellent. She has carried out careful and well designed parametric studies. The reports reflect meticulous attention to case selection, treatment, and statistical assessment. [liked her work sufficiently, that when l was inviting scientists as associate editors of the new journal, CONVULSIVE THERAPY, I invited her and am pleased that she has joined the Board. She is an excellent reviewer, and recently she organized and reported an assessment of the characteristics of two new ECT instruments (CONVULSIVE THERAPY _2_: #3-54, 1986). I think the evaluation is fair and very useful. She also has reported an interesting meta-analysis of the studies of unilateral and bilateral ECT. She is a delightful person, and apparently well liked by her co—workers. She lectures well. It is a pleasure to recommend her promotion. My regards. Sincerely yours, Max Fink, M.D. Professor of Psychiatry wags—aw - Nun—u: u-u � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Murphee, Henry B. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-030-8-247 Date A point or period of time associated with an event in the lifecycle of the resource 1986 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/2674d85d3a5826f77be637615c99aa9b.pdf c2ed304bfecaee00b1c899e9367e6fe9 PDF Text Text February 24, 1986 Henry Murphree, M.D. Department of Psychiatry Rutgers Medical School Piscataway, New Jersey 08854 Dear Henry, have received a note from Helen Pettinati regarding my willingness to act as referee for the departmental consideration of her promotion. 1 would be delighted to do so . i first read Helen's work a few years ago, and have since come to know her and her co~workers quite well, and admire their professionalism and excellent work. When 1 took on the position of editor of CONVULSIVE THERAPY, I invited her to join the editorial board; she has since been most helpful. Let me know what I can do. 1 ---—v —, qua-"w... v—wm- '"T’r ,-. my .Ww" My best regards. _ Sincerely yours, , 7%? '7vvrw-wv wn—n—rrw Max Fink, M.D. Professor of Psychiatry WW» m—v r.wmr wnn w, Ip—vrrrvn‘ ., WV W —. ‘mvw . van v. er~ MW � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Murphee, Henry B. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-030-8-256 Date A point or period of time associated with an event in the lifecycle of the resource 1986 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/eb09bed5f08e2c78a2d819255459d338.pdf b667bb47c37108bf5984995c9b5ca9a1 PDF Text Text August a, 1963 It“. Bob ”Way King and Murphy 1m. 1311 mmMiami St. Innis 1. Wilding Dearlbb: Immmwiduofusingthemtiealtneonm than in your proposal. I name ma swat ynu mmfmmtthisismdeofgms,ammtitia W.ttntmmumbeabletomtmsomdmh Mammary. I mllainthaWestWingLabcmmiamom-nmtm. include Also,inviewoftheaostoftmmofaarpetinthc would you please write the spacifieationa for tile Library, waimilaraqual? Sincerely yours, Maxﬂnk,M. Dinctor- w-h\‘1f ”(www.mu..vm....—w~yr-VA <4175JM—‘V‘Huqlr‘p , ‘ Arm”-.— —1~—*w «mun-Urn. lum— w-ﬁﬁ—rmw D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Murphy, Bob Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-368 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0ae24bfc1320fe16d3525308654bc7fb.pdf 32532eaf3517810247fc49e982fed97d PDF Text Text - ~ - . . t r .. , «1— we: . 1-- erw- <-rwﬂwwwmwy)vmjwmvu;c ‘Wy‘l‘azvv-m'" January 25, 1977 Dr. Derek Murphy Medical Research Council 20 Park Crescent London, WIN HAL www.m-ry— Dear Dr. Murphy, "WKLIKVUI’w-vuwv'v”! .,-c-.m.o~w to England While I know the time is short, my plans for my visit have been finalized this week. I shall be in London on Saturday/Sunday, February 12/13. If there is merit in meeting Saturday morning, I can arrange the time. "-r «"177 I have requested accommodations at the Athaneum Hotel on Picadilly Road, and a message addressed to that hotel will reach me Friday evening. My regards. Sincerely yours, mm")! y—r-r- a»: W,“ “mum-1v- 9177."! a...“ .‘nws “93" war-rmrnv'srm-m unwv In 1 v'tvnilrvr‘a‘l' -rz:.ur.~.-m ,vnrwr—v. wm-w- “warm ~ K Fink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Murphy, Derek Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-5-249 Date A point or period of time associated with an event in the lifecycle of the resource 1977 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/01ce1f82fd15ef2544ea2518cb18d3b5.pdf 99b425de42bc8610aab71ceb909f2a51 PDF Text Text June A, 196k 1.. Murphy mm.“ King and Murphy, Inc. 1411 Ambassador Building 3:. Louis 1, uncut-1 Dan: Bob: letter of June 1, concerning the Hair and Lint 1n the what “in; laboratories, my associates and Interceptor Hr. “hath find no objection to this relocation, and auggest Ragarding your that ynu incorporate it into the drawings. Slaceraly yours, Mu Fink, Director Hiljﬁ cc: Ht. R. H. Chapman M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Murphy, Robert L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-4-440 Date A point or period of time associated with an event in the lifecycle of the resource undated Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e81b34a717a86aef7907ae177c56244e.pdf 4af60b6b890ba94f64326adeb9fb1301 PDF Text Text ”.1 ,‘ ”gnaw“. ..m..4 Saptcnber 6, 1968 M»,- 1 (no: Lamar—r1, Dear Murray, Tha menbcrship committee chairman, A1 Frcadnan. has asked that we supply him with an accurate count of the membership, no that he can plan for the additional members to be invited. that your - list Hy lists are not up to dntc, and I believe in probably the bent. -:-w—:.W~a< -'r‘h'«‘L mm“: wnuwv-vwar-w ﬁbula you ask your sacrotnry to make a count of the members, less the honorary and other spacial categories, and lat me know ? Many thanks. u :r 02/- UV A Sincerely yours. Max Fink, Md). � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Murray Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-5-511 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/349fe2e3125f258ef9a8d81d5afcce0d.pdf 90298c4249f87ed75571a78e7f70a0a6 PDF Text Text August 5, 1983 Mr. M11 W Rom W Haalth Facilities Division of Facilities and Fasoumes Rational Instimma of Hoalth 30mm In, Maryland Will: Enclosed m revised pages cf tha application FR 03087. Boar Mr. WehavenUtmviudmel,mtaskywtoaltwﬂu from $113,275 to $130,768. wasted atmosmlmdmplampages 5, 6. 7. 12 and 13; and 18, 19 and 20 to complete the amount 8, 9mm; applieation. Moopiesofthedmwingsmalaocmlmd. Wynnfwyounhelp. Simon-137W, Max may» 3110. 'v‘ .w-thgrw’w ,. Fink, Director M. 1). � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Murrill Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-364 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/cbed2ae5c07ff9e43aa5675ca6101ca7.pdf cd0937deb95b57e18881bbbedd3dcbb4 PDF Text Text March 30, 1965 Joaa M. Hnaacehio, M. D. Laboratory of Clinical Scienca national Instituta of Mantal Eaalth Bazhaada. Hhmyland 2001‘ Daar Dr. nuaacchio: for your lattar of March 23. 1965. 1 plan to ha in Washington for a ﬂoating of tha Clinical Committee Thank you vary much on April 15. and 16. 1965. I an: hawa'tha pragran for choac days yat, I baw‘ liava that I will ba fraa eh: avaning of tha fiftaonch or for lunch on tha aiztaanth. the Iaatinga axa navally held in Building 31. If it is aaraaabla with you. I would like to call you hater. tha tifcaanth and nah: a data for us to mac: at nonatiua during thoaa two days. Whila do Sincaraly yonra,‘ Kl: rink, M. D. Profaaaor of Psychiatry Misty � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Musacchio, Jose M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-2-146 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/25b66c1b5d7a33627032f4f5bca40fc6.pdf d6ca99a7aa0a3110352d9d2c213488c6 PDF Text Text W April 5. Mamie, H. D. Batman, Hazyland 2001a Jose H. 1955 Iabomtcry of Clinical Science National Institute of Hental Haalth Mama: Mmforymmteloplme callmismming. 1311313 to confirm that I will ho at I». Patiniem on west 55th ('9 Dam mu _ Strut in New York on may, April 1%, at 8:00 PM. 56th) If for my mam you have 3am difficulty in making this would you plum call my father's offim 212 TI 2-1888 or my faﬂmr's hm 91h PE 8-0862? I I led: forward to using you. Sincerely yours, Max Fink, H. D. meaasor of Psymiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Musacchio, Jose M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-2-164 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9f2019420bf4d6b2318b582bc606209a.pdf b4e82cfe5a8fa0de36d367e42c8e3e68 PDF Text Text May 8, 1967 Mr. Want A. Muth 808 West End Avenue New York, New York 10025 Dear Mr. Muth: Thankymverymchforcaningtovisitus. Idonot we rave an opportunity for your talents at this time, buthopethatwexraybeabletooallonyouassoon think that asourprogrammquims it. Sincerely yours , Fink, M.D. Professor of Psychiatry Max MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Muth, Lorant A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-021-5-296 Date A point or period of time associated with an event in the lifecycle of the resource 1967 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e7b9b9ec85027ce003b91b70c09aa7b2.pdf 146ba59d35b64e8dc39a49250369bfbb PDF Text Text -'.xz--V.~anwvwwrs- rut-r ' 'r'r 1“qu __.,.. w." .,_w, y........_“~-q_~,.qn V Nut-"‘1“ .n-a WWW—"m war. .m $-emw-wv»a.» -w.- “tent wsmv< nvw— «-—=-w-n.4,. November 20, 1970 Mr. James J. Mynatt Assistant Director Legislative Council State of Tennessee Committee Nashville, Tennessee Dear Mr. Nynatt: Enclosed are two recent reports describing the present findings in studies of narcotic antagonists. The use of the antagonists is limited by their short duration of action. The need for laboratory studies is great, but these are funded inadequately. of a long acting depot antagonist will provide a logical treatment of opiate dependence, particularly of young persons, and a prophylactic. my estimate is that, with financial support, such a development may be available in 1972. The development Sincerely yours, Fink, M.D. Professor of Psychiatry Max MF:kt enc 0 . 7.9.“ A � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mynatt, James J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-9-478 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9e69300d414b9466088f5c6ddc4ba1dc.pdf 5666ce8eafc23d28e0400c1f979962c1 PDF Text Text q». Mew 25. 1978 Dr. Margo Nedien Social Seienoes Division Fordhsm university et Lincoln Center Lincoln Center, N. Y., N.Y. 10023 Dear Dr. Nedien: Mr. Gillespie, e student at S.U.N.Y at Stony Brook. is scheduled to receive his Ph.D. this week. His work here has been exemplary end he has completed his studies with skill. - My acquaintance is limited to hie-pertioipetion in my seminar on "Brain end Behevior". end his work Iith e peptide, ACTH h-lo. In the seminar, he was an interested and active participant, and completed his assignments well. In the study of ACTH 3—10, he examined the effects on attention and learning in monkeys. Again. the work was done with care but the results failed to show e drug offset. . He V is a skilled experimenter and I position in which his skills may be recommend him useful. for a Sincerely yours, MFahec M31 Fink, M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nadien, Margo Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-029-2-081 Date A point or period of time associated with an event in the lifecycle of the resource 1978 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1e67008d2391680b74b6f13cd10db415.pdf 2608dfe76c34f4e8ae1346342c0e593a PDF Text Text March 1, 1971 Mrs. Zahida Kissuna Nafees 1287 Madison Ave., Apt. #7 New York, New York 10028 Dear Mrs. Nafees: I regrot that our programs do not allow us to appoint a research fellow at this time. As I know your husband, I will keep your record in mind and if our situation changes, I will contact him. Sincerely yours, Fink, M.D. Professor of Psychiatry Max Mszt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nafees, Zahida Kissana Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-3-262 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/24a84ec992173ccc5e311612e899c3dc.pdf 6a7069a80d0bf3a404facc9eb1ca599f PDF Text Text pm 23. 1986 Sim 21. Chaim, Healer. 24.13. Waco on ma mutt» The Madam of Psychoanalysis 125 Exist 55th New York, New Yak 10021 8% Dear Dr. Raglan meat!» fwam of the hammer W farmlopportmityto mammalian coordinated affomo. Putnam tbs fallouing juin in any Wyomifwyominvitation the Newsletter. more am inSt. fa»: puma]. note my be of interest. Fink has been appointed m 990me of Psychiatry in the Dr. Dew-tum of Psychiatry at the York Midi“). College in June. New Dr. Fink has been the {bat Director of the Himm'i Institute of Psydmiatry and Research memm at Washington mimity since 1962. You my also wish to not: the mntinuaticm of our studies of LSD with m. Jaffe. collaborative We Institute. :m for a smsaful armiwmary issue. Fountain and Dnhlborg of the William Manson White Beat smartly ywrs, Wajmh Fm. Mob. m meamr of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nagler, Simon H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-3-195 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/42cbb7a4bc4741327ebc6be3c8c9eb8e.pdf 29fc01d45b4bb9c68c81087cf1b3844a PDF Text Text ‘ "WW-"WW rummvw- WW.mmxiww‘ “a WWW-w“,«mp-unm rv-m , V , , . “we-WW we. , . , meumw ,, W "ma-mm _, um .‘lm-‘WHW."M_.‘.., w , w. W._.w..~~,uu—w-xmWWII—V February 4, 1970 Dr. Simon H. Nag1er Department of Psychiatry Metropo1itan Hospitai Center 1901 New First York, Avenue York 10029 New Dear Sy, he have no "innovative” ideas on how to supervise residents mode] in psychiatry. We have proposed that the continuous care on emphasis of the Division of Bio1ogica1 Psychiatry, with our tempora1, artificia1 a tota1 treatment approach, without a usefu1 experience phi1osophica1 or moda1ity restraints, may beone-ha1f the patients than more we that aware are for students. - and higher reuadmissions services are admitted to our inpatient emphasize, therefore, some experimenta1 of interest. approaches to therapy, and this, in itse1f, may be uni1atera1 ECT as innovative, are Sure1y, some of our techniques and mu1tip1e monitored ECT for depression; na1oxone, cyc1azocine f1uphenazine enanthate as “engagers” for opiate dependence; injectab1e and doxepin and decanoate, and e1ixer butaperazine for schizophrenia; and high dose ch1ordiazepoxide for anxiety. Hot to forget ourand specia1 interests in 1actate precipitab1e anxiety, cannabis, for drug abuse subjects. We EEG. V ,, “WWW“, ,; 'M'm w.» .r- - a staff Sureiy, among this wea1th of nove1 experience, withFe1dstein (Professors); Shapiro Kee1er, consisting of Drs. Fink, Simeon, Vo1avka (Associate Professor); Dornbush, Resnick, Rubin, and Zaks (Instructors) Major (Assistant Professors) and Abrams, C1are, and we shou1d be abie to engage a group of enthusiastic,bright dedicated residents in a reciproca11y rewarding experience! ,. Sincere1y yours, “n“, n n Fink, H.h. Professor of Psychiatry Max ‘1',“ ’ . .11" MF:kp wwl‘wm‘ww-we-gm, wnwm :i- -' “2,1218 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nagler, Simon H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-2-067 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/28348df3bbc5f89d854fed510776896f.pdf 4062fce9ce2efeba022cc2d0d82333a2 PDF Text Text W m. H, 1963 Vwan Nair N. MW in Mickie Medical Gonna Hospital mm, 3. India Boar Dr. Nair: Dr. WWGdWNmJemyWW mm to mfer yaur letter to m. Imstiwco was kind . initiImtitute of Psydmiatw is a sister W3 have Jersey Numb-Wade Institute. The Missouri tutim to the New similar {militias and have similar oppmuﬁtioe. Ifywwmldbeintomtodinjaﬁningastaffsumm m,lmcnclosinaanmtlimofcurpmwasmnmm mﬂeatimfm to your lotto». you have participated in Wing WWMIWb-intomtodinthomfemto a, any ardent: which ycnmylmn published. Sincerely years , HEX Fink" Director Hrmla ﬁne. 2 M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nair, Vasavan Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-8-541 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/012c49793d07092d58811bc4f3b128e8.pdf d8dfb769a5514a8dfe15b47e18cb3401 PDF Text Text Dumbo!- 8, 1965 — ~ u- ‘ﬁvvvrr—w-Wv m. Paul Nairoh nun—rah . v...- ‘ of Pydaiarzy Immunity of California in: Angolu, California 9002!: Dar Dr. thoh: Imdaliglmodrmrmbodyismd’dngobookabmm analyokeﬁwouldbeplmdtooo—Wwimyouroﬁu bardmabnhy. Somalylmsmmgyourrampﬂnra whid'ammmrodaowollmoopiesofmofﬁnmpm‘ts mammaaymmmmmm. Inhm mist-d mmﬁrh theiﬂsylru. Uthomionoimdimmm,ﬂnmrmdmwinbe 15h; Minn outpost a“manning :00 cour- and availabhwiﬁainafwwksmdlwiumdampymroym atriarriu.1fthemiommmroobrainam1minary oopymlhr,mommaotodoso,butmmrhcmcb1oaof oditimvouldbaoauimoﬂmt. W mkvmtronorimofirooﬁurirmybammmuymm. and mummmmrommdinhwwhmﬂmsryhofyowbodc I can pmvido you with information whim is partiwlarly Goodludc. Binoculy yours. Mu Pink, ml). of Psychiatry Wm HPdcp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Naitoh, Paul Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-8-657 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a0c9c4d84bf23498202b9be735aec17f.pdf f25054d4a76e2c9de79d3364dec7a58f PDF Text Text March 20 , 196R Hr. Yoshimase Neitoh 1282 Hewitt Avemae St. Pam 1:, Minnesota Dear Mr. Naitoh: I have moeiwd a copy of your mrrioulxm View, Mom, Dr. Guam Heistad. Our from my laboratories in mmmyeiolom are well established inmirolinioal program.butumbesioanimellaborawould Nameless. I likemdisomymcurriwlmuvitaewithewrberof who month. In the event that tomes are firm; being developed staff will join us next us to consider an additional staff it new possible forIwillwrioa that rim, toyou. InthemanMarat hold slwuld like to tine. I your macaw vitae. our Sincerely yam-s , Hex Fink. Director Mljb 14.1). � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Naitoh, Yoshimasa Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-2-242 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8d84e56d9b70ce9812298c546769c9c8.pdf 5fa8b88c46f98e0eee909cd8e10b441d PDF Text Text septenber Dr. Vellejo mjere Secretary General xv World Congreee Celle Atoohe. 106 23 . 1966 of Peychletry Nedrld 12. main Deer Dr. uejere: Attheendoftheemeluoz 'Iewﬂende 1n Peyohophereeoology." I wee told that the principal presentation end ducueelone would he publlehed in the Proceedlnqe. I an enoloetnq. thezetore. en original and one copy 02 the tent o: ny dlecueelon. Hey I take thie opportunity to then): you end the organizing coulttee to: your klndneee 1n inviting ee. 1 found the Comte” noet etL-nletlnq and em: to congratulate you on the breedth of. the preeentetlone end the efficiency o! the organisation. Sincerely your... rm. o! Peychtetry Proteeeor ﬂex Ln. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Najera, Vallejo Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-7-421 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/dfb449901b81653dee5025a256e24b21.pdf 5afadfd4f0b1a1b7d03a2a2472e38825 PDF Text Text Dr. mar-aux ﬂakannra Kata Gijuka Enivaraicy Scheol of Mbdicine 35. Shinanomachi Shiujukn~kn Tukyo. Japan Dear Dr. Hakannra: thank you for your tenant latter. photograph taprinta. I have aubadttad your curriculum vita: and to the Chairman of the Departuaut of Psychiatry. and am plaaaad to tell you that his preliminary evaluation has been vary favorabla. ”He has raqnaatad that I writ: to Drs. Mlura, Hakita and Eara for spacific iniormatiou re~ gardtng your abilitiaa. I am doing so now. and look forward to a apanifia appointaant within tha naxt law "a“ . ' a If aha lattara a! racnauandaetan aatiafy the administrative afticara of tha'univaralty, I vauld be plaasad to-racanuend your appoincnant an Instructor in tha Dapaztaant. I: unuld ha cur intautian to haw. you participate in tha animal raaaarch program. now undar way in razordtns and analyxlna aha brain name pattarna with a Vida variacy of psychotropic arms: is dogs. I believe tha baa: tachniqua would be the {uplantaxion of elactrodaa althar on tha Aura or ‘1‘: unaar aha data in four or at: Incationa. It would be ideal if aha lead virus cauld ha drawn ta a aoékat which 1a plrmanancly implanted on tha aknlt. Baeordius eonld than ha accompliahad with lung laad viraa in a traaly Having animal in a canftnad enclosure. entrancly. although of coaauhaz laaaar incarnata fine a1actrodaa in various locatiana in tha brain for chronlq according: using a variety of naw coapounda. would be the implanaatton of I scan: thta program interests ynu, and I look forward to tha Untvaratty'a appointnaae batng anda, alfaetLva aarly in tha aunuat. If tha appointmont wara made as of July 1. 1965. would you ha prapaxad to davalop your program about that tins? Sinceraly yours, - n£;1a nun. 24.x); m Profaaaor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nakamura, Mareaki Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-2-105 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/ed16cc00d15cc2b8ec28c36ac3cb4708.pdf 687f05e543e58aec6c55406a665e7995 PDF Text Text Jmuary 7, 1965 Dr. Mareaki Nakamma Keio Gijuku University School of Medicine 35, Shinanomchi Shinjmm-ku Tokyo, Japan Dear Dr. Nakarmma: letter to Dr. George Ulett was referred to me for a reply. the Chaim of the new Department of Psychiatry at is tre Missouri Institute of Psyclﬁatry of the University of Missouri School Your Dr. Ulett now of Medicine. - In reading your letter, I find that you have some experience not mly with clinical neurophysiology but animal work as well. At the present time, we are considering establishing an additional laboratory forthe study ofbrainwave inimplmt electrodes indogs. In this position, we are seeking somebody with nemcphysiological mcperienoe with animals who cm impllmt electrodes, prepare the proper recordings and make ﬂue necessary analysis so as to provide a comparison for the chm effectsofdmgs indogs aswellasman. Wearestudyingavar-ietyof psychotropic arms in this study program. ' Before writing to your references, I Would like your opinion regarding such an opportunity in exper'iunntal neurophysiology in our . animal laboratory. If this position interests you and. if you have ence insuchwork, Iwouldbepleasedtohearfrmyouandthen to to Drs. Mime. Makita and Kara. In addition, we would appreciate a small photograph and an indication as to whether you are married and the size of your family. _ Sinoemly yours , Max Pirﬂc, M.D. Director. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nakamura,Mareaki Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-1-030 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9c9c9600219a3b69b5af81130e5766da.pdf defc465b5d02a03ec79227e488b0fa2d PDF Text Text 7383:666 May 8. 1973 Jules M‘ssernsn, M.D. 6 South Michigan Avanue Chicagc. Illinois 60603 Dear Enclosed is an edited proof of tbs contribution to thc ncxt volume of Current szghintgia Tharagies. There are a few g E minor corrections. chiefly in the eitaﬁionn. Thare are two omissions. however. which I am bringing to your attention. E ' 3 E z g Jules, ditttrant ,F\ , The footnote, assisting thg reader to separate the forma of long acting methaaels is amitted, and I has. added it. The credits doletcd.uy geknowladgement to my co— workers, and to the funding agencies which have supported this vamk. I an incluaing skate with the request that these debts be anknowledged. volume. My thanks again for inviting my participation in this Sincerely yours, max Fink, M.D. Professor of Psynhiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Narcotic Control Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-2-210 Date A point or period of time associated with an event in the lifecycle of the resource 1973 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/03f1d715851326cdf0a0167abbc24962.pdf 6e41b1c81af92369b4d7df840aca56f5 PDF Text Text 7483-01783 Stanley F. Yollss, Max M.D. Fink. M.D. Capital Equipnsnt Tbs docunantation of rsports is an essential product of tho taaching and rasaarch functions of tho Dapartnant. Such docunsntation raquirss rspsatsd rsprodnction and an srror-frss tart, particularly for statistical computational information. The MT/ST providss tha facility for storags of tsxt, tablas. and statistical data for rapaatad raptoduction in a variety of formats. Instruasnts of this kind can, with an adsquats supply of inaapsnsivs atorass tapas, provids for periodic updating of dapartnantsl reports. A aingls instrunant can ssrvics from 6 to 15 scisntista (astinats hassd on prior sapsrisncas at two similar psychiatric facilitiss). Display Monitor Modal olzwgoktrogia (yard Copy Unit 5610 Tsktronix) Bquipnsnt now availabls to tho Dspartnant of_Psychiatry ptovidss for data procsssinz of usurophysiological analog data for studiss and trsatnsnt of psychiatric patisnts. Data input laboratoriss ars sstablishad at sach clinical unit of tha Dopartnant. Tho csntral procassor has only a lino printsr as a hard~copy output. This doss not psrnit graphic display. although programs are available. Thass two units. Display Monitor and Hard Copy Unit. ars additions to tho available squipnsnt to provids graphic summaries of physiological data analytsd by tbs cantral processor for can at distant installations~~our clinical cantata. Such units must ha nodifiad for tho central processor. and rantal is not an scononical courss. PDP 11-60 Contggllar ranching functions in nsurophysiological assays in clinical psychiatry raqnita that studsnts batons acquaintsd with controllsd *1— �8. P. YollssI M.D. ~2~ 11 anusty 1975 sxpsrinnntation sud controlled data procsssins. Tbs PD? 11-40 allows ths systsnstic prsssntstion of stimuli sad thc rscording of rssponsss of up to 8 concurtcnt cxpsrissnts. cithsr in patisnts or voluntssrs. This procsssor will be ussd in teaching nsdicsl candidstss and post-doctoral csadidstcs. Tbs instrussntstion also mskss possibls thc systematic recording of acutephysiological dsta with idsntificstion of stimuli on ths rscordin: tsps, such that ststisticsl processing will be possible. MF/cis � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Narcotics and Dangerous Drugs Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-5-419 Date A point or period of time associated with an event in the lifecycle of the resource 1974 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9c17c77cb4a6dae7f194441d095d9c29.pdf 18fbaf9f36c23da4258e483b5bfd75f6 PDF Text Text STATE UNIVERSITY OF Nii'W YORK AT STONY BROOK Health Sciences Center - School of Medicine 3I Q Department of Psychiatry and Behavioral Science Psychopharmacology —— EEG Stony Brook, N. Y. 11794 Phone: 516-444-2447 Laboratory April 27, Michael Natale, Ph.D. College of Physicians Columbia University 722 West 168th Street New York, N.Y. 10032 & 1977‘ Surgeons Dear Dr. Natale: scientist who may become interested in Dr. DiBianco at Misericordia Hospital. is linguistics The only has applied for an NIMH grant to study behavior changes in patients undergoing hemodialysis. I sent him to Dr. Jaffe for advice. He You may wish to contact Dr. Joseph Mendels at the in Philadelphia. He is a biological psychiatrist with wide ranging interests in novel methodologies. Good VA luck. ‘Sincerely, Fink, M.D. Professor of Psychiatry Max MF:fg � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Natale, Michael Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-5-234 Date A point or period of time associated with an event in the lifecycle of the resource 1977 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/732b862732bc195f941234b3808e20df.pdf 83c378132b21617b701b0a3d0a2461bc PDF Text Text : r‘w'vnw—Vm‘xw ~ ’ ». . - « ~ ' ,; ’K?" mpg— ‘ Aprll l7, I970 Ir. Davld Box I439 M. Nathan Amherst College Amherst, Massachusefls Dear Mr. Nafhan: have presenled your leffer +0 8 number of my associates, regref +0 say fhaf we have no poslllon lhls summer. l and Your credentials are exemplary, and anflclpafa Thu? we wlll be worklng next summer. ln fhe evenf you are ln+eres+ed ln parflclpaflng in sfudles of drugs in volunfeers, would be pleased To hear from you. l I Good luck In yoursfudles. Sincerely yours, Max Flnk, M.D. Professor of Psychlafry MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nathan, David M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-4-185 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e885e5e25ca8bd5b08ac4065257cf6e4.pdf 41f09835ccbfdbbf03c338b5e084e700 PDF Text Text Wor- 6, 19% Dear mu Nathan: Wmformmosnthttermidnlhavo Wcmuld brosghttothsattantim ofwassooiatss. hapleasedtomyoujoinmhnstitutemditis. ourmomndationthatymworkwiﬂnmhnthestudy panama dedicated to modifying the behavior of one sowmmntallyill. milethsmlsofdmgthempy . inthsmagomtofsushsovsmlyillpatimtsis Wotudy,wsamfullyoognimtofthsmodforintonsivo and social therapies milieu, psychological The monologue-Til management of those patients is a ohallongo and while is more difficult and more can» of ambulatory wtmpatients, plcx them the it Wit thebasispsydnologioalmdnmimmasﬂmortmtin thosopatiehts as thsyaro inthsmildmsntally ill. It would not be consistent with our presont pro- mtoprwidsadmlmimnt,whiohisisplisd in quostim regarding "thus or four patients that your I could see in out-patimt clinic". Mover, all of our patients following discharge am in our am after sore mitmdlmuldboplsaaootohavoyousmrvissmd participate in that prom. W,thsmisap1mforyoirpsyohodynmic interests undnr. G. allocate Ulstt Wmthatm aportionofyowtimtothosupswisimmdtssdning We of our resioents. wand be pleased to provide an for opportunity you to supervise resident physicians. in theoamoftheir'patimtsandinmemsolutionofthsir interpersonal diffioult’ias, either within the Institute or within the general hospital. The wards of such supervision are usually great, and proviso a successful ammo for the expression of psychological intsmsts. I look forwardtohaving you joinpus. Sinosmly yours, - mf/ls H. Natlm. M.D. Gainssvills, Florida ' Max Firnk, LLB. Director � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nathan, H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-7-749 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e6df294318df260ab99771c412327836.pdf 636490391cf409652dbab93da29cddf3 PDF Text Text 4 July 27. 1966 Habib Harlan, M. D. The J. Billia Miller Health Center Univaraity of Florida Gainnavilla. Florida 32603 Daar Dr. Nathan: Thank yen vary much far your racenr letter of inquiry and your curriculum viral. I found the letter quite interlacing. and unuld be glad to prunes: your appli- cation further. I: would be advicabla £6: you to send us the names of thrae rataraaa to whan“wo may write regarding your arpcrianca in psychiatry. Alto, we would appreciate a small photograph. In the avanr that the references are satisfactory. I will arrange for a perronal interview. Singeraly yours, 1 Max Fink, Director Mfljb M. 1). � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nathan, Habib Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-5-551 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c87d559ba3e2ca01947b84125c94f7c1.pdf 4f97d7203822e44d156e6f26fc843314 PDF Text Text October 1, 1964 Habib Nathan, M.D. University of Florida Gainesville, Florida Dear Dr. Hathan: I have checked with the other people in the Instituto and find that Saturday, October 10th is preferable to Monday, Octobir 12th. I would be grateful if you could arrive Friday. in the evening, and be available at 9 a.m. on Saturday, October 10th. Sincerely yours, Max Fink, Director mills M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nathan, Habib Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-6-654 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/998bfa121138424cc2bb04d9785841d6.pdf 99d3f5bb46effcc2b29cfd0b67dd4ce3 PDF Text Text Jammy 25 , 1965 rm. Habib Matt-m. M. 9. 271-45 samm: Village mung, Hedda Dam Dr. 32503 Nam: Wemﬂdbephmdtohmywjoinmmsuffin recommended the July. I have your appointmnt to Mmityofmsmmdﬁnmdatimhasbem mpt‘adbothbyﬁnﬂuirmofﬁwmmtmd mum. AtmpmenttimIamwaitingmemual mingfmﬁmactmlappoinnmtbymmw Multan. WtWafmqmmmm. Shambattﬂked,ﬂn1nstituteisrmtm of Psychiatry of the mimity of mm. mdmmpmmmdndioatod lytomcamhmd tothe 1 Implmedﬁmtymmpapermpm-sdwolsociopaﬁxy MahmaempmdbytheAPA,delookfomdto Inplmmingmmﬂmtmﬂng. Wit. mdpazhnpswwinhavamopportmdtytodisms mpmmingmaterdctail. Ilodcfowardtohavingyoujoinus. Sinoemly yours , Dr. Mm: Pink Professor of Psydmiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nathan, Habib Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-1-049 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/005f08d2c5dbab37a851c502b68a9417.pdf 3b4dad7a708d5f0b93916cb7a966b4c7 PDF Text Text . wmwww .1.va.u,7—, ,- .7...“ _ , _ nun-r. ~n- w. x m October 12, 1966 National Aeronautical and Space Administration Washington, D.C. Gentlemen : Would you kindly which we may write to 1965, edited by I... D. indicate the appropriate office to obtain a copy of NASA Report SP-72 , Proctor and R. May, which compares man using various EEG changes in This study has been cited in a methods. quamtitative recent review and is of specific interest to us in this the masurement of Departmt. Thank you for your cooperation. Sirwely yours, Fink, M.D. Professor of Psychiatry Max HP:kp ' . Vw ma WWW ;v'~'!J-I""4I'I � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: National Aeronautical and Space Administratio Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-7-445 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/73aa37b670eeb54e1aa4213ba63af426.pdf 1293340bf4c6458127847da8554887b4 PDF Text Text murmur-m November 7. 1968 Office of Information Nationai Institute of Heaith Bethesda, Haryiand 20014 Gentiemen: appreciate receiving a cony of.“NIH Almanac 1968!. an information bookie: on the National Institutes of Health, as described in a recent issue of Science. He would Thank you. Sincerely yours. Fink. H.D. Professor of Psychiatry Hex � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: National Institue of Health, Office of Inform Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-6-627 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4273ade19e9d73b9060d80896387f506.pdf 50dec3a0c8b6d5643dfdc3e48b43d41d PDF Text Text kWh-A -»-— mm,- 7' rung-vwvwn 7383-82558 20 December 1973 Dr. Miles Matousek Klin. neurofys. Lab. Sahlgrsnska Sjukhuset Bjukvardsfﬂrvaltningen SWEDEN l Gﬂteborg Dear Miles: It was very kind of you to send me the program for Hjorth's I have given your output to Dr. Shapiro and he has promised to give me a Christmas present of the program. Should it be running. I will obtain these measures in addition to my usual frequency measures in my next drug study and, hops~ fully, should have some information for the meeting in April. Should it be possible, I would like to visit your laboratory when I come to Europe in the late spring. I shall probably be accompanied by one of my daughters, and I will use the occasion to see some of the sights of $wedsn. analysis of EEG. Last month I visited Jiri's laboratory in Basel and was very impressed with the organization, equipment, programs, and enthusiasm of the unit. For the first time since 1966, I believe Jiri is happy and productive—~although he did complain that he was tired of studying ergot and hoped that Sandor would find a more stimulating interest. Voita has assumed the responsibility of my former laboratory with enthusiasm and is doing a magnificent job. He has apparently convinced the funding authorities to give him ad— ditional equipment as well as to set up a laboratory in Copen— hagen. I see him as busy as I must have been when I had that position. There is something about life in New York City that makes men run when others walk. Here, in the country, men walk and I seem to have plenty of time to spend with my family, for which I am most grateful. �"a...” Wyn-v, .u- Dr. M1103 Matousak Again. that I will My -z- 20 Dtccmber 1973 thanks for sending me the programa, and I hope have some outputs to show you in the spring. my best rusards for a healthy and happy 1974, Stncnrely yours, Fink, M.D. Professor of Psychiatry Max MF/cis � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: National Institues of Health Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-4-264 Date A point or period of time associated with an event in the lifecycle of the resource 1973 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0f1cd7c5d58a1efa67523e32fc3bab04.pdf 3233104d1868cdc84ec6ff43cde2ac84 PDF Text Text November 6, 1978 Office of Research Reports NIGMS - NIH Bethesda, Maryland 2001h Gentlemen: We \ would apprecaite receiving single copies of the following publications for our use in the teaching of students at this Health Sciences Center: Inside the Cell The New Human Genetics An addressed Thank you labll is enclosed for your use. for your help. Sincerely yours, Fink, M.D. Professor of Psychiatry Mex � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: National Institute of General Medical Science Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-029-4-150 Date A point or period of time associated with an event in the lifecycle of the resource 1978 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence