37 100 6561 http://exhibits.library.stonybrook.edu/mfp/files/original/f2653ab113c0003085b06f370ec47d35.pdf 7251891bc84590465f6b126853085285 PDF Text Text Hay 31, 1966 Wendell R. Lipton-rt, 24.1). Chief of Research State Hospital WmCslifmxia Tame. 95%]. W Dr. Lipsm: ---of reprints which describe m are a inthselscm-c— ofwwsmtmmrdingmm” with The drugs. bibliography W m Wmie of whim you speak is Oumalmt 23 of the and mum be available in your library. EEG Jamaal, .Pefinpslwfildbeofmmhslpmyouifyouwmld www.mmammm ledtoymmintsmt inthe elmtmmphslogxw. it has been opinion for my my years mat each of fire peyamnwie drum are effective mfimextmtmtm‘alwmsmmelwtmand that in time patients in these WWis m mange do not occur. the therapeutic results are manually most calm with depmsim ma mcimphmnic year. This those receiving not only drug therapies patients, but other somatic: therapies as wall. ”My It has also become very clear that psychotropic drugs hallucimgmic agents each have gate specific aims Warmth eimtumpmvidoanadditimalmyinalmsifyingdmgs and in the and bummed EEG pattern changes. their effects. I met this is helpful, and: questions. feel free to smite to College, 196th and 5th The if you have any more me at the AW, flew York. specific York Medical MYork 10029. New: Sincerely yams, Fink. I'LD. Professor 915' Psychiatry Max Mdeh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lipscomb, Wendell R. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-309 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a1e626b62f04fdcd0d1c6845168ce9f2.pdf 9d646fd736e3a94a7aacc190ceeba624 PDF Text Text vmv,1-r<.« r. ., . . ,,v._ .. ,. -.. , ,. '“vr'm. .... 7:“. -W a: f‘FV'vflYfl "“h‘w‘ll‘l‘.’—u(tfi‘ wwwwu-s-;nanuw .. “w"w’WWWrrwflv-awnvwvmwlwx- ' s-u NF. 9......“ ..,-. -Ww.mmwm- .. I-‘-"r'*'>—L‘-:\-'Wr~ A i - mew October 11, 1976 Morris Lipton, M.D., Ph.D. University of North Carolina Chapel Hill, North Carolina Dear Norrie, I am working on a project involving dietary factors in hyperkinesis; In talking to Judith Rapoport, she told me that you had chaired a committee review of the Feingold and other hyptheses for the Nutrition Foundation. we ... my a copy w-n-»L;-.-wvm7.w~mw‘nw,., ACNP ? Is the report published Thank you If not, is it possible to obtain ? for your advice. Now that the chores for the are over, perhaps you can get back to more My self satisfying regards. W'HV yaw-aw, Sincerely yours, 1ym"m. urn-m «mummy: Ww'l (mum—r . v: immannxrxnwmcvwn :«r Wm. r- . ‘Nn-nnam"qu-':v'l .1 , .. .‘qm‘ar-ww-n Jaw" Fink, M.D. Professor of Psychiatry Max work. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lipton, Morris Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-4-182 Date A point or period of time associated with an event in the lifecycle of the resource 1976 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/70efd8bb19131471f3bf50608e789a0f.pdf 69ef4bc4f1e3538253b2e9c2984b6999 PDF Text Text »- 7,. .7- .w— i A .w 7', .m—mr. . . , ..i . .mm..~.-;u.w,...m.... , ._ A-mwyv,ww\'¥ .. ,.. «rm-uw-‘w .. - --.~---—»r ur- *W'avn —.-.————-_~.—_...w»- "wrwa-r v -v-’-—vp- . . "an-h” mmv - fflm/MM December 1’4, 1987 Morris A. Lipton, M. D. Deputy Editor, American Journal 93 Psychiatry 1400 K Street, N. W. Washington, D.C. 20005 Dear Morry, It was a pleasure to talk with you in San Juan. On my return, I read the letter by Lieber on the "Treatment of Rapid Cycling Bipolar Patients"in the latest issue of the 5.13. The letter recommends complex polypharmacy as a treatment of therapy resistant depression. But the letter gives no data as to patient characteristics, history, in-patient or out-patient status, assessment of efficacy of treatments, trials with established treatments, Egg. The letter seems to be a throwback to the old—fashioned testimonial which modern psychopharmacology eschews. letter is published in the Journal, it suggests that the practice has review standards of the Journal and the Association. Do spontaneous met peer in response to an article'in the Journal, meet the peersubmitted letters, not review standards of Journal articles? Was this letter reviewed by any of the acknowledged psychopharmacologistsof the Board of Editors? If yes, is there a message in the letter that our attitude to polypharmacy should change? As the if no, would you consider soliciting letters to argue against the adoption of the Lieber recommendations until they have met established standards of study for efficacy and safety? a fact of practice, as we often read in the which records come our way, polypharmacy is not generally condoned malpractice by our experience or by our science. is the publication of this letter not a regrettable mis-step? While polypharmacy is My best regards. Sincerely yours, Max Fink, MD. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lipton, Morris A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-031-3-063 Date A point or period of time associated with an event in the lifecycle of the resource 1987 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0ff8907f464add63ebdd6cc0cdd6a8b6.pdf 397b1634d74252eb25fc5e7195822537 PDF Text Text April 26, 19 72 fir. Frank J. Liska fianager Corporate Data & 6. Information Services D. Searle & Company IND. Box 5110 Chicago, Illinois 60680 r Dear Hr. Liska: Thank you Statler Hilton. for the invitation to breakfast on Hay 18, at tbs I look forward to meeting you at that tins. Sincerely yours. flax Fink, E.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Liska, Frank J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-2-202 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b66613279c283e6a219aa0a48d691541.pdf f790c5c2e5309715a7c803da9b4dae18 PDF Text Text 7383~?10 June 19th. 1973 Mr. Gary Boynr. Center ibr Studies of Narcotic. and Drug Abuse, Nutiaaal Intuitute of Mental Health, 5690 Fight?! Lane. Knoxville, Maryland 20852. Dear Mr. Boyer, A: V! have discussed, w. are studying the effects of unrijunnu inhalation in ahronia hashish “sure in Athcna, Greece. undnr the ntudy pwogrwu 38M h2~70~98. Our luficlt pw¢3e¢t, thrlnl;$efi in conjunction with Dr. Btnvt saarn of HIMH,1¢ : study ef’th¢ errant. or scuxe withdrawal in those nan. Boasuua we fibula like to limit the tint If snaking, and haeanao than: man have a high auarec of toleranoc such thni thay achiave noun satisfaction only when they htvo snakod 120~180 as equivalent TEC-A-9 hashiah,¢r unrisuaaa. we are reqnnnting n supply of mnriJunna vith a high aoneontration of wao~A—9. Ehia will permit us to have fins subjects snake within a 20 minute smoking period and coneeatrntn our behavioral and phyliolosieul observation: under’gontrullcd eanditioas. I an enelaning a BNDD order for: 2220 far 500 grnas nuriaunnt (2.5} wficmbp9‘oqnivnlont). It in my intention to trannship those ta tn: university of Athena under an ‘import permit that Dr. Stefania has recoivud. and with an export license which I an requesting eoncurrent with this letter undar Iehedule I). my BxDD rogiatration PF0100759 (exporter, ihank you very much for your gocperation. Bingercly yours. Fink’ ”.90 m Profousor of Psychiatry MF/iJ En” ‘ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Liska, Frank J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-2-160 Date A point or period of time associated with an event in the lifecycle of the resource 1973 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/cdac1abcfa05378ea136e80c6d3c3f82.pdf d32b333a93ef5527cb866bae9577794f PDF Text Text October 3, 19 83 Dorson Liss, M.D. Chairman, Special Procedures Committee Good Samaritan Hospital 2425 Samaritan Drive San Jose, California 9512!; Dear Dr. Liss, The literature on maintenance ECT is not reassuring. The principal studies in my book on ECT (Pg 207). The APA Task Force was unable to find detailed are satisfactory data to allow a recommendation, so reference to such studies was included among the research needs in the Task Force Report. This question has been asked by a number of other respondents. The best suggestion that I was able to make reflected the present practice on my service at University Hospital. About half our effectively ill patients who respond to a course of ECT are discharged on maintenance drug therapy, usually imipramine, less often lithium or phenelzine. When such patients relapse, and recover in a second course of ECT, we then consider discharge on maintenance ECT, initially recommending weekly treatments for 2 to 4 weeks, then bi-weekly for a month. We have not treated a patient beyond 6 treatments as an out-patient, always trying a second course of a maintenance drug trial. I am not satisfied with this experience, and did propose a study which was not approved by granting agencies. would be grateful for a copy of your recommendations when these are adopted at your hospital. I Thank you for your inquiry. Sincerely yours, Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Liss, Dorson Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-030-4-093 Date A point or period of time associated with an event in the lifecycle of the resource 1983 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3c2cd7e05377ae12e1e4211cc3d65041.pdf 6eb46b31eaf8c79a975795ecf12265bf PDF Text Text June 10, 1993 Dr. John Little H&CS Lakeside Hospital Gillies Street PO Box 63 Ballarat 3353 Victoria, Australia Dear Dr. little, It is not clear why you sent the proposed guidelines for ECT to me. The best U.S guidelines are those proposed by theAmerican Psychiatric Association Task Force in its 1990 report Electroconvulsive Therapy: Recommendationsfor Treatment, Training and Privileging (APA Press, Washington DC.) or the 1992 text written by Richard Abrams (Electroconvulsive Therapy, Oxford University Press, 1992). Both contain the present consensus in the US. regarding all the questions you summarize in your report. I attach some specific comments on your document, which may be idiosyncratic with me and my team. There is no experience to warrant or justify any specific decisions regarding pulse width or frequency in treatment efficacy. Swartz makes claims about duration, arguing that some brief pulse trains at 4 to 8 seconds are more efi‘icient (more effective?) than the short trains of the MECTA. There is evidence that total energy (mC) is a factor in efficacy when unilateral electrode placement is used. For my part, we are dedicated to the THYMATRON device which allows changes in energy and duration. When we use the MECTA device, we use the SR—2 as the more facile of the MECTA devices. In the US, it is no longer acceptable to undertake ECT without EEG monitoring; we would no more think of unmonitored ECT than we would think of unmodified (no anesthetic) ECT. �Page 2 I have not been to Australia, and would probably be pleased to come if the arrangements were suitable. Much of what I know about modern ECT comes from articles in Convulsive Therapy, the quarterly journal now in its ninth year of publication. I do not think you know it in Australia -perhaps you could subscribe and educate your peers. Sincerely yours, Max Fink, MD. Editor �Page 3 Electroconvulsive Therapy: A Medical Guide page 1: In discussing theories, why not cite the neurohumoral and the GABA-ergic hypotheses? These are detailed in Convulsive Therapy (vol 5, #3, September 1989). page 2: Why is catatonia cited among both psychiatric and non-psychiatric reasons for ECT? And what makes the non-psychiatric 'controversial'. For catatonia, if benzodiazepines are not effective in a few days, ECT is clearly justified even in catatonia secondary to systemic disorders (lupus, typhoid, NMS). The contraindiCations are not consistent with the APA discussion. We no longer accept any absolute contraindication. We now approach each case with a risk/benefit analysis, and if ECT is commanded by the psychiatric conditon, no systemic condition is seen as a contraindication. page 3: ECT was not the first effective treatment for mental illness; it was believed to be effective for dementia praecox and that was its novelty. Inanition and manic delirium are conditions that should be added to the list. We would not accept the statement that the anesthetist decides whether a patient is fit for ECT. That is the psychiatrist's decision; the anesthetist is to do his best with what is given to him, much as he has to do with traumatic or non-elective surgery. (When ECT is compelled by a patient's illness, it is not elective.) page 4: It is too sanguine to say that permanent brain damage does not occur. At times, as a result of poor techinique, a prolonged seizure is not recognized, an airway is not maintained and a permanent dementia ensues. You can say that 'permanent structural brain damage does not occur under usual treatment schedules'. page 5: A common problem is post-seizure agitation or delirium. For consent for ECT, we usually insist that a 'significant other' to the patient consent as well as the patient. �Page 4 page 7: I believe fractures occurred in T10, not T5. Pre—oxygenation does not reduce the seizure threshold unless you have evidence not in our literature. The efiicacy/ energy relationships are restricted to unilateral electrode placements. Brief pulse currents produce less cognitive impairment than alternating currents. page 9: I cannot believe you mean 2780 amperes -- perhaps milliamperes? Any reference to the electric chair in an ECT document is pejorative. Delete it. page 10. AT this late date, you cannot be serious in stating that the observer can tell when a seizure starts or ends in ECT when patients are effectively paralyzed and asleep. In our studies in 1980-81, we showed that cuff monitoring and EEG monitoring were essential. By 1987-90, we became convinced that EEG monitoring was essential, mainly as a protection against missing a prolonged seizure. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Little, John Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-033-3-067 Date A point or period of time associated with an event in the lifecycle of the resource 1993 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/adfbcc6911fca8b2bf75783ecb9d986b.pdf a39bd902638f492f9b9ec45705dbcb26 PDF Text Text Felruary 10. Bar. Robert B. Livingstm, Chief General Research Support Brunch Divisim of Research Facilities and Rational Institutes of Health Bethesda, Maryland 2001» 196% Rams Dear Dr. Livingston: The Psychiatric Research Famum of Miami is a men-profit corporation established to support the research activities of the Missouri Institute of Psychiatry and was awarded the follcwing research wants dwing the period July 1, 1962 to June 30, 1963. ‘ m1 MB 07071-01 Effects of diffemnt 07072001 Survey af NH drug use group behavior period beginning Juna 1, in a state ital gariatric 1962 population Wt 072159-01 and hm $27,565 Wt period beginning October 1, 1962 $19,886 NH trmquilim on Wt $19,188 EEG period . ‘ 1):prth 07u32-01 Behavior changes with induced Gmnt $20,710 wind September 1. 1962 altered brain function beginning January 1. 1963 mm is $06,307. In «mining the eligibility of this inatitution, I would be grateful if you would consider the followdng facts. The Miami Institute of Payohiatw was mated by the Governor in Jar-3m. 1962, and was «M with an initial mating budget of $300,000 for the: 1062 1060. This sun of of was Jme The mm period of January 1, to 30, my �Dr. Robert B. Livingstm February 10, 2 196% exclusively devoted to the monarch program of the Institute. The expmditms included salaries of new pummel, equipping tho laboratories and beginning the numb promos. For the biomim beginning July 1, 1963 the sum of $338,990 was warm. airing the initial year of operation of the Psychiatric Research Foundation the Institute, a nmaber of monarch 3:10ng wore begun and applications were mach to NIH by June 1, 1963 for oonsidoration by the October Comoil. have already bean approved effective January 1, 196“ for an Four eddit?ago sun of nagqao for this year. (See Appendix I). Appendix II is a oopy of the current Intoml Remus: status of the Foundation. The Foamdation was gramme! a axe-pt status in and tow Fomuary, 1963. An application is now pmding before the Internal Revenue sowioo for a permanent omption (Appendix III) . Psychiatric Femoral; Fomdatim of Hisaom is a nonaprofit corporation its own Board of Directors. The Executive Dimctor of the Fomdation is the Director of the Missotmi Institute of Psydaiatry. mo Pomdatioo was mated with the approval of the Governor and the Director of the Division of Mental widowed. Dr. George A. Ulott. Dr. Ulott is Vice President of the corporation. The with the power to Operate on the promises Missouri Institute of Psychiatry and supervises all pants and of the awards of the Institute peroaml. The scientists appointed to the Institute appointed to the Psychiatric Research Fomdation. are The corporation has been given may The Psychiatric Reoeamh Fomdation does not laboratories or research own does own mvoable equipment made available either through facilities, but NIH funds of the or some private dmoro. Tm byulawo of the corporation require that in the event the corporation is disaolved, all the equipment will be made available to the Mesouri Institute of Psychiatry, at public body. . Since tho Fomdatim does not om research All of the studios are done or other institutiom of the Division facilitioa, it does not com; out at the Missouri Institute of Psychiatry of. Mental Diseases of Misaowi. the emoeptionof using its funds for research at the Missouri Institute of Psychiatry, tho Fomdation does not disbumo funds to other organizatims to do research in tinir facilities. With ' I trust that this hfomtim is sufficient to make possible a favorable determination. It is the intent of the Dimotor of the Division of Mental Diseases to ornate a research facility in St. louis which will em out many of the studies needed to dawlop a better mtal Malt}: program in Missouri. rm its conception in Jammry. 1962, through the dedication of its facility in October. 1982, to the present, it has shown a rapid growth. m1 �Dr. Robert B. Livingston February 10, 3 swport mm}: new 196% funds muld do mach to make possible the spmaoz‘mip and the appointment. of supporting suiantista as they become available, without the intarfemnea of the delays maimed by application to NIH and Pomdations, or the biennial actions of the Hissouri prom. of ugiflam. Trunk you very mm for your consideration. SW13! Max Mfzaw Pink, 12me ,. em. (8) yours. Ho Do Dimotor �APPENDIX I Hi 08MB Psydmpimoolow of the Lithium Ian M 08517 Thump)! Resistant Psychosis and New Drugs Antmiats to mtidmlinerac Psymotmfimtics m 072u9-0231 EEG and Hum: Psymowmlogy Mi 08597 TOTAL $ 19.750 38,0“0 73,200 23.936 §207I926 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Livingston, Robert B. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-1-116 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c21b3877880d7eb26dc6f11a50fdd67d.pdf 198cd2dce017035c804acd2a9b760594 PDF Text Text June 2!. , 1966 Lloyd mph-r, Ltd. 36 Hubby Sqm Immmmt mmmm(mclof¢mate) Imam inflahmtumofflnmhhmlo‘hym. mmtmformy anm‘midxingunmny “mummmmmmuamotm W,wmnuflutodmiml morphmutiealm mmmmmnmmwmm. Thank you for yaw W101. Simly yam, Haxflnk, 14.5. Manner of HF:)<p Psyolfiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lloyd, Anphar, Ltd. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-375 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1fcf9034cbbded6c6423416581677b1c.pdf fe96ee185d7e2fe59dfbdbcc81e4638b PDF Text Text 28 , 1966 January Dr. Bill woke Coordinator of Research Twining Bureau of Child Research Parsons stare Hospital and Training Center Parsons, Kamaa W Dr. We; Imwritimatthamqmtofm. (1»me inapplyirgforapredootmlmimeshipinthemof wakesearm. of Mr. Galloway joined flan staff of the Missouri Institute Psychiatryonmerl, fifteen maths approximately for ammowithm time he was this a Ming 196a, . tedinician in the mumphysiolow program . He damnatmtad an ability to loam EEG tedmiquoa , to utilize the amputer equipment available at the Institute and to carry out a umber of projects related to marinara}. psydnlogy. He had an worriding interest in operant cmditioning. Wen it obvious that the program at the Institute were mm hm broad mug: to support fixis intamst, we encouraged him to the trainingprogram mnbeingestablished in mly Kansas City in this field. m. Galloway is a personable to young man with enthusiasm He has ability drive. marinaded and electronic oquipoent. Maugham in hmdlim and His interests are well focussed. thetimwithusfnwasphasmtmdfrimdlymdmnliksd minim inexperimnm payflwlogy byhiamiccrs. Iwmldenowmgehimtooontinmhis Sinmmly yom‘w , Firk, PM). Professor of Max Wary � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Locke, Bill Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-1-076 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/402d2e16dcc8695b4d7dec3ba0b9127f.pdf a88f8f8a6a8baef7964d0fba42c2d4a6 PDF Text Text 10...» r): (.7. err-w . .,&,.,._. ..._ .V 4.. .,.. V a. u“ MW." - , r r , ‘ , ""?""“"""" ""-“’“-V“"“"""""“’ October 31, 1969 Dr. Simeon Locke Boston State Hospital Neurological Unit Boston, Massachusetts 02124 Dear Dr. Locke: I am honored and pleased to accept your invitation to participate in the Thursday afternoon conferences at the Boston State Hospital on January 15, 1970. It is possible for me tojoin you earlier in the day. As I understand your note, it would be two presentations quantitative EEG analysis in psychoPharmacology and drug induced denial as an index of organic brain disease. The order is whichever is most suitable for you. I will be bringing 3 1/4 x 4 1/4 slides. Thank you for your invitation. Sincerely yours, Max Fink, M.D. Professor of Psychiatry MF:kp ’ ’W.«w-w-RT —,,;~wh- 'xnc. , hiw’ ~ > ~— � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Locke, Simeon Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-5-437 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/bdaeb31304735334d1bdc1737a04f759.pdf 366a64c082d13e872fd61a29466b6239 PDF Text Text August 13. 1953 W Disposal 0mm mm of coups Granite City, Door Sir: Dopot Illinois Hissmmi Institute of Psychiatry is a ram laboratory m of the Division of Mental assesses of the State of flissowi. We for electronic equipment which is freqmntly amilsbls Imuld assm'pluspropertytmmwsuchasyours. 4cm: may be information the applications to as spymiate sass masonryfos‘fliislmmtoobtainlistsofavaflabls miss equipmsnt at frequent intervals. have mod Thank you for your cooperation. Sincerely yous, Fink, Director Max Mfam M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Loehr Employment Services Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-381 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1d4b39d746fd7d0cc11e45c37c11a930.pdf 3e5628c545763b2f84a034e866e45ec0 PDF Text Text June 28, 1971 Dr. Bernard Loev Smith Kline G French Laboratories 1500 Spring Garden St. Philadelphia, Pennsylvania 19101 Dear Dr. Loev, It pleasure to discuss your interest in THC derivatives and I do hope that you can arrange to make supplies available for BBC studies this fall. was a visited the University of the West Indies in Kingston to review their cannabis study program for NIMH. I met Professor W. R. Chan and Dr. K. E. Magnus, and they described two unusual derivates of their hemp plant which they have isolated. Their formulae and a citation of This last week, I a similar product isolated by Obata and Ishikawa ace attached for your interest. Sincerely yours, Max Fink, M.D. Professor of Psychiatry MFtkt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Loev, Bernard Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-5-297 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f6f8236bfc0ec8e2838f90f9053538e6.pdf 99d7b6cd373f37a09eea815ca72f1ca8 PDF Text Text October 3, 1969 Dr. Jose R. Lombillo, Director County Mental Health Clinic, Inc. P. 0. Box 1302 Collier Naples, Florida 33940 Dear Dr. Lombillo: Membership in the American Psychopathological Association be recommendation by members of the Association. May I suggest that you look through a recent volume of the of the Association, published by Grune and Stratton. Proceedings The annual volumes contain a list of active members and you should feel free to contact any of them for a recommendation. is The next meeting of the Association will be on February 13, 14 New York Hilton and the subject is ”Disorders of Mood and Affect”. Non-members are welcome at a $2.00 registration fee. at the Sincerely yours, Max Fink, Secretary M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lombillo, Jose R. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-5-489 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/547599f1406ae5348c803e26cf4bac96.pdf bd43e22774ada8451e74019fc2741a2b PDF Text Text //f - _//’1 pecan”. December ]S, 1971 ‘Jnn'ur-r- - .e—r—.;mwww,w-—a.r Mrs. Roberta London, Mg. Ed. Contemporary Drug Problems 515 Oxford Street Westbury, New York 11590 .wmmwmw“”””” \~em. Dear Mrs. London, W's-"fir”, I have re-written the article on opiate dependence, under the title, Treatment and Prevention of Opiate Dependence with Narcotic Antagonists, and sent it to my typist, for delivery to you early next week. It is sent on the understanding that it will be included in the 1972 issue. Spring, As I discussed, it may be useful for your editors to con— the sider invitation to some of the scientists interested in the of problems drug abuse to your Board, and I suggested that you consider Dr. Alfred M. Freedman, Chairman, Department of Psychiatry of this College, and/or Prof. Stanley Yolles, Chairman, Department of Psychiatry, State University of New York at Stony Brook. Both these men ahve a long history of interest in the problems of drug abuse and have maintained a balanced and theortically sound position on most of the contemporary issues. of Cannabis, will require that for the antagonists. There is so much research activity at present, that to be timely the article should be prepared at the latest time possible to meet your deadlines. Depending on the time of the year, you should re—extend your invitation The other re-writing even article, Biology more extensive than about 10-20 days before the final deadline. difficult to meet your request. Good luck It should not be too in your endeavor. Sincerely yours, Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: London, Roberta Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-9-558 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/aefafe983fdf3b55e0aada9ae1016801.pdf 3882baf5196b37369a7641eeeadeb5ad PDF Text Text February 22, 1972 M133 Roberta London Monoging Editor Contemporary Drug Problems 515 Oxford Street Heatbury, flew York 11590 Dear H139 London: v'- made, the biography submitted, and the I nave added the latest data to the text, and the title shortened. N133 and the White fiance report should be most timely, for the USPHSon- the antagonists, which SAODAP are both preparing larger programs should be announced shortly. The own—mop." “h... .w awn..-” — v ~—~w-w corrections are additional chores, should you docide to prepare a cannabis issue, our studies of the acute and chronic effects, both in New York and in Athens, are most interesting. While I am not looking for I look torwcrd to seeing your anwwuuy—mv— first issue. Good luck! Sincerely yours, , A —». an: Fink, M.D. Protector of Psychiatry -~v~mr——wmm.._ Ming Enc. . W.— A .mmm » "' mm. - w”- 'w-pm - �Dr. Max Fink is Professor of Psychiatry and Director of the Division of Biological Paychiatry of the New York Medical College in New York City. Since 1966, on has extensively studied the neuro— physiologic and clinical effecte of narcotic substitutea and antagonieta in opiate dependence. and the effects of chronic cannabis use, both in the United States and overseas. He is a graduate of the Rev York University College of Mad~ icine (1945); is certified in neurology (1952) and paychiatry (1954) the American Boards of Psychiatry and Neurology; and in paycheanalyaia (1953) by the William Alanaon White Institute (New York). In a research career begun in 1954. he has been Director of Raaearch at Hillside Hospital (New York) (195A-l962), and Director of the Missouri Institute of Psychiatry, and Raeearch Professor at Washington University (St. Louis) (1962-1966). by Hie principal studies are in the neurOphysiologic (electro— encephalographic) and clinical effects of psychoactive drugs and coneeileie therapy. Applying computer methods to these analyaea. he has provided theoretic models of the relation of EEG changes and behavior in man, and of the node of action of convulsive therapy. He has just edited a special issue of Seminanb in Pbychiazay devoted to convulsive therapy, and will chair an international symposium on this subject in collaboration with the Rational Institute of Mental Healtu in 1972. Institute of Mental Administration, the Columbia Broadcasting Syetem, and numerous industrial concerns. He is the Executive Di— rector of the International Association for Psychiatric Research, Inc. He is married, father of three, and is a resident of Great Neck. He Health, the Long has been a consultant to the National Island. Food and flrug � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: London, Roberta Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-1-068 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d30efba40a36760da9ceb6c0e1aace17.pdf a7b2c0afc107d7edf2c38800d802720b PDF Text Text . - - - -* '2'~*<->~> -- mun—m :w..w—,..wmu.w.m.w «w “n"‘m ”mm.wv—vw'v’-—q7vx~ p..." .,,-.....,. ,,_,__ a... m’lxk'fiw—W 1.“:r-,..,..~,~m~-_—.-..—r..~.r»w.r Ref: 72-301N June 23, 1972 Mrs. Roberta London Contemporary Drug Problems 515 Oxford Street Westbury, New York 11590 -Dear Mrs. London, with much first issue of Cbntemporary Drug Problems interest, and found much that was new to me. I hope you I read the will be successful. I have read the articles by Samuels and by Hochsteeter. They are disappointing. Both are vague polemics, hoping that drug delivery problem. will, in some undefined way, solve the Opiate dependence Neither provides answers to the technical issues with which we have how to select patients; how to deliver drug safely; grappled—— what about spillage; what is the duration of the treatment; etc. More important, neither gives a clue as to their view of the etiology of dependence and how heroin delivery will serve the patient, or even society. Perhaps the third paper is better-- I should like to read it if I am to provide a commentary, which I will do gladly. Can you send me the San Francisco report ? Yes, I should be pleased to participate in a panel discussdon on heroin maintenance. I will try to bring to it the technical issues which seem so complex, the problem, of 'after heroin, what then?', and, so as not to be wholly negative, some alternate solutions based on a different view of the etiology of drug dependence. I do not know whom else you are considering for the panel other than the well known advocates (Vera representatives, Samuels). Have you thought of some official points of view, as that of BNDD (Haislip), SAOBAP (Jaffe or Kramer), NINE (Bunney or Petersen), and the Marijuana Cpmmission (Brill) ? Good know it will luc} in your succeed. new venture. It serves a need, and I Sincerely yours, Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: London, Roberta Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-2-154 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/dbeb0b9c5c9765c06e93fd9414f9a1bb.pdf 06e792d2b0c743534d8bfbe87d82e7e0 PDF Text Text August 9. 19Y2 Mrs. Roberte London Contemporary Drug Problems 515 Oxford Street Wentbury, flew York 11590 Dear'fira. London: The suggestions by Sennela, Hoehetetter. end the mittee (Contamporery Drug Problems) Lari? Con- for e heroin delivery experimflnt are well motivated, but they do not consider the severe practical problems posed by the suggestions. In selecting heroin. they select the drug with greatest risk (high lethality for dose), shortest do» ration (requiring moat repeated administrations) and least stability. They propose an experimental patients who have delivery in failed other treatment programx. livery is to provide all patients trial for heroin 100 to 200 The heroin de~ a method of engagement, and within the year, are to be admitted to other treatment programs, partic« ularly narcotic antesoniets, methedone, or drug-free. The principel benefits of the program will be the incorporetion of a small additional group of addicts into a prevailing treat~ meat regiment (which, presumably, they bed once before as a vague test of the British experience. rejected); and �.hm. uoberta London August 9, 1972 base proponents cannot be homework, for moving done for besides the questions that are raised moral, legal, and from the commended historical grounds, I would raise practical Ipharmccological) point of View. on their social, ethicnl, some questions Heroin, morphine, methadone, and levouethadyl represent feur compounds (Opioidsl they are most similar in on a continuum: their patterns of physiologic and behavioral effects it man and animals. They exuibit patterns of crosantolerence, for each can substitute for the other, and each achieve cos may be given by any bodily raute and still effects. Their principal difference lies in their dura- tion of action, with ueroin'e effects lasting the Shortest, usually from 3 to 6 hours, and levomethadyl the longest, from 36 to 48 flours. duration is important in selecting appropriate dosages, for with short acting compounds, physicians have the most difficulty in for their patients. Thus, in see stabilizing rue effecto they wish looting heroin. the authors opt for the most difficult and most ex‘ pensive delivery system. we and from it is have had extensive experience with heroin that experience and pleasant bodily effects. and unusual changes in recall it's other problems for heroin: We propenoity to produce a variety of unhave observed seizures (convulsions), heart rate, respiration. sufficient irregularity as to lead patients with caution. two stability, requiring careful handling for a compound of low sustained efficacy; can administration, us and senaorium with to administer heroin in our �Hrs. Roberto London prevailing A Anguet‘S, 1972 View of drug dependence emphasizes the signifi‘ cance of conditioning and learning theory an the basis for etiology and as a key to the alleviation of the In suggesting e here syndrome. i oin delivery system, the author! disregard this one method of cipel advantages of this paradigm have merit. methadone has been its However, should the authors wish repeated injections, adone, which select the edninietretion, the repeated intravenous, that will enhance dependence, should route. View and why One of the prin~ usefulness by the oral to engage their patients by have they not recommended intravenous meth- is achieving some vogue now in Brithin, and has the ad— vantege of a longer duration of action and less frequent administra— tion? Granting a successful delivery system for heroin to a select group of patients, what is the anticipated gain? That these patients will be available for after—care programs, of methadone and cyclazocinel If that is the real goal, to reduce crime by buying these patients to participate in the eyeten, would it not he more to the point to more adequately finance and increase the number of treatment programs so that more The patients can be more adequately reed selected by Samuel: and Hochetettcr is one that is easy to recommend, but for potholes. treated? Should this reader. their enthusiasm for one that is full of rut: engagement not they would consider the expansion of levonethedyl1 and pale, perhaps trials es e more �mw‘ are. Roberta August 9, 1972 London logical substitute for heroin for Don and methadone; or if their enthusiasm Quixote causes can be sustained, they coy investigate the evi~ dence for the development of a long acting narcotic antagonist.2 Such a development has theoretic, therapeutic, and prophylactic possibil- ities to commend from public it, and yet is receiving the bares: of attention authorities, while much eneggy is dissipated on the pro- motion of heroin delivery. Sincerely yours, flax Fink, 3.9. Professor of Psychiatry MF:13 1. Zaks, A., H. Fink, and i. E. Freedman: Treatment of Opiate Dependence. 2. Iink, H.: Treatment giarcotic Antagonists. Levomethadyl J.A.M.£., 220: in Heinteuance 811—813, 1972. and Prevention of Opiate Dependence with Contemp. mug Ptoblema. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: London, Roberta Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-3-255 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/189a61ed91e90204ee01d5d83f54be2e.pdf 6c29c7f9ee7b5e296b63765c627dc441 PDF Text Text December 23, 1972 Roberts London, Esq. 515 Oxford Street Westbury, New York 11590 Dear Roberta, I have read the transcript of the heroin session with interest, and wish to congratulate the primary editors, for sending me such a clean transcript. I am especially grateful that you deleted some of the 'off the record' remarks, and in that context some of the discussion on page 25 seems audacious, and probably should be deleted. . I have translated the 'qéfl' designations to English; and have typed a few lines about the use of fialline-- you may use these as you wish. I have added a few sentences to the last paragraph, noting would I that not hesitate to support a study of heroin, either as a delivery system or as a pharmacologic study, in order to learn more about its effects. That should be enough, but if there is reason to give more support for a scientific study (say, through Yale University) and not a political study (say, through a nonscientific and non—medical agency like Vera) I would be glad to do so. . I have also added a reference to the article in your earlier issue, referring to the narcotic antagonists, hoping that such a refernece may be used in the text or as a footnote, to bring your earlier report to the attention of the readers. After all, a critic who is wholly negative contributes less than one who provides a better vision and for My and an alternate road towards a solution. best wishes for the continued success of your journal, a happy and a prosperous 1973 ! Sincerely yours, . "Ir luvs”. m ‘ {we . Wv'w gu:( w Il‘nfla'fm‘ Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: London, Roberta Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-6-429 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/71ca7d4f4b45a24bfbf4fea53afae992.pdf daf5d264fa971410d70f2a9a1739a2d9 PDF Text Text Mr MP9 I. 1mg A. 6, 196%; ' Southeast Bank of St. Loni 2301 South Kingnhigmay 81:. 10.113 Dear Mr. 10, mam ‘ Long:- It is with appmciatim and gratituda that I accept your donation of $100.00 on behalf of the Psychiatric Research Fomdation of Hissowiq ‘ Yom‘ mntributim will be cf 3mm: asistanoe the research and teaching activities being established forin the benefit of pemms with mental illmsses. $11163me yours. Max Fink, M. 1). £2me Director MF:AW:bw � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Long, I. A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-7-740 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d39e116b4de1533415817ad935955e68.pdf ab06e7f4eb8ec4f176cf7f1901f58e40 PDF Text Text chmbor 22, I. Mr. A. Long, Bank Wat 1965 President _ 2301 S. Kingshighway 9:. Louis. Missouri Dear Hr; tang: ' Enclg’sed are copies of the Board' a resolution mgaming' the budget of the Hismi Instituu of _Plyduiatry,midxmmttothnmm, mdtha mply which is sent-to you for your Wows: informtim. ‘ . The next meeting ‘of thc Famdatian will be lmdwon meeting on Tuesday, Jmuaxy it, 1966, at a 12:20 p.13. at the Missouri Autistic Club (1605 Washingtm, 3131:1113, Hisscm‘i‘). The aganda will, be short and is plum! the meeting will and Mom-2:00 p.111. V it Sinceme your: , Fink, Md). Exemrtiw Director- Hm: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Long, I.A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-7-620 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/2df9ad18eec292d59d5859948fc8c9e5.pdf d4fb49ef81539c385a7ea35bd164f10e PDF Text Text December 9 , 1965 Dr. V. 6. [man laboratory of mmwical Matty d1 Sanita Institute Superiom Rm. Italy Dear- Dr. bongo: Thank you vary web for your acceptance of our invitation to participatu in the symposim of the GIN? in March. I would be grateful if you would send a copy of your exeellent mview, whim I hava just road to the Oo—daaimm of the symposim, Dr. Philip (The Hediaal School, Binningham 15, England), no that we can make a proper dispositim of our tine follwing Why your mmt. - m The pmgm is being Organized and as soon as I have specific details. will write to you. Also, yam:- mquast for financial assistance will be inelWed in our final request to tthINPCmitteomdweshwldhavaamspmsefmnm some time in January. I a: looking forward to your participation. Simmly yam , Max Pink, M.D. Professor of Psymiatvy Wzkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Longo, V. G. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-8-666 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f28244a73f9795e448bfde809f6d5131.pdf cba417e69930ad0fde5220e253576ef6 PDF Text Text January 18 , 1966 Dr. V. G. Longo Laboratory of mompeutiml menistry Istituto Superiom Di Smite. Vials Regina Elena, 299 m, Italy Dearnr. largo: plunged to confirm the invitation for m on Antidxolinergie Hallucinogena your pardoipdtim in the Dr. Bradley and I menu forthcoming meeting of the CINP, to be held in Washingtm, 13.6. on March 29 md 31. We look forward to the pmsmtation entitled Effects of the Behavioral and As there am still a few qmstims of Atropine and Related at the flammogmplfic "WSW mm.” mmwilityofmofflnmpominvitmtoattendthe muting, it will be a few weeks before we cm send a definitive pmYourand tin sohodule. for support during your stay in the United States must has been subudtted to the minimum of the: Program Comittee, W Wm Brill and Cole. Dr. 001a has indicated that he will give priority. However. the definitive this must the will not be sands for mother few weeks. financial that every Plum meant the want-moo of the Prom Comittee ten dm‘ing‘the be: made for expenses provide your to will effort Dru. will be presented during each three hour session, alluring thirty-five Wes for each pmsentatim and discussion. Since the dismaim may be of apocial intemst to the pwticipants, (Ihavemadyour flumponshouldbeaboutzcmimtesinlength. would and that you could hope deal intemst of with a great smut-y in tho allotted in man, data the emphasizing amazfze the findings, Five mports to midor the publicatim‘ of this Insofar as this subject is becoming sepamtely. bellow that the association of the we lumingly in single volm will be a valmble work of the participants a in making a mwoript and ask ooopemtim mntrdlmtim, your The mammript should be meeting. time the of available at the 20 pages of text, plus bibliography and illustrations. The CINP has permitted us swim Want, Wtely �Dr. tango I do «2» January 18, 1968 not believe that the mpublioatims of your review would be as helpful as a sumary statemnt of your own data. Porhaps you would writing a of your msoamh and pmmting son» of the data, specifically any of you more mount studies which my not yet have been published. wider awry Since we would like to print a program including abstracts for distributim at the meeting, would you favor m by a single paragraph or two describing your presentation? I led: forward to your presentation. Slowly Max Fink, your-s . PM). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Longo, V. G. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-1-044 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/720cee0b7f3457e47bf76fad8150a396.pdf 6ccde0a22f2ffd744b013e07b6cb5a2f PDF Text Text _ m. V. E. tango Laboratory of lhmpentieal Istittxto Superiom di Smite: Pane, Hammer 12. 1935 Mm Italy ‘ Dear Dr. bongo: The C.I.N.P. Brow Camittee for the; forthcoming meeting in Hashingtm on March 28~31, 1966 has asked Dr. Philip 31’le md myself to arrange a aymposim an the general tepic of neurophmcolow. We have decided to mange a swim outta subject of: W3 - a WWWIC . Anticholinemic hallucimgens have' received considerable study and the data relates to the pmblm of central nervous system dzalinergie mechanism in the bffects of various and to the special problmn of the anaemia.- micof mama, and behavior. trim Watic EEG kmmizing your expérim flifi‘l these ammds and yam interest in these problem we mum like to invite you to participate in this 1. If you am able to accept this invitation, would you please send an a gamma titlc for your pmmtation, and a manpammphdescvibing the focms andtypeofdatayouwish to pmsem? Upon moaipt of these achmledgmnm , Dr. Bradley and I will make up a rammed pmgmn balancing the time for magentatime and discussions. The C.I.N.P. has agreed that this symposium will have at least onemane session of simultmeous translation, 8a thtt reports may be present-ad in tha lmguaga of your choice. _ wim. ' . 2. me C.I.N.P. has not stated a general publicatim policy and we propose to publish these reports md discussims as 5 separate volume. ~ , . anticipates that each participant will pay in attending this mating. For those attending from Europe, a charter flight my be organized by Dr. Philip Bradley. 3. his cm Tha C.I.H.P. was �I Dr. Imago ~2- Member 12, 1985 In the event that travel ftmda are necessary, please indicate the requested to supplement your available funds and we will transmit these requests to the Program and Executive Comittees for their decisim. mt u. The are being emu” has asked that we indicate maximums made by: . Hargmt K. Taylor c/a C.I.N.P. Secretariat 3636—18131 Street, NW. Miss ' Washington, D.C. 29010 If you am planning t6 attend this meeting, to bar directly? Dr. Bradley and sympoeim. I look ' would you forum to having you join us in Sincerely yours , Max Fink, PM}. meessor of Psychiatry MF:kp write this � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Longo, V.G. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-7-601 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0ef4b709733fcc32fa602a3f4dbea720.pdf 5dce10a40d4edfcd81d918cbed7ff243 PDF Text Text Juno 2!: , 1966 Dr. V. 8. ItalyWm Institum Ram, Lounge (11 Sanita www.mngm , wwwarmmmmwaftmcnmm submit abstracts of the wardens papers premtod that asked swim for publication with'the Wm. we at the CD? Ihawe takanmeIiNrwofathmcfingflmamyof yum report and am enclasing a mpg fox~ your consideration. Immmiommfinedim,butwfllthamviaed mimifywuishmmctitmdmittommfly. May rm for m participatim. Shandy yams, Hm: Pink, H.D. of Psychiatry Wear Wzkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Longo, V.G. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-370 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/214005647936ce2f02bae9281d2a3fa4.pdf c2e3ec299488767f261eb69c2151c6fb PDF Text Text u - __ -. a». _ v“,— —.~-. .9, V. ,, ...w mr.ufi_. vmm,_—w:r'_7 : Aprii 29. 1969 Dr. V. G. Longo Istituto Superioro di Sanita Viala Regina Elena. 299 w- Rm. Italy ‘W.,...AW,.-vaww’w-mw Wm-" Dear Dr. Longo: Thank you for your invitation to participate in the Program Committee of the CINP in Rome. I vii] be arriving on Monday evaning May 5 and will cail you when I arrive. Sinceraiy yours. ‘ H Fink. H.D. Professor of Psychiatry Max 3 : wm'w.rv —<—~ v- wy-v-w- W. a mu Mszp , � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Longo, V.G. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-2-102 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0ade53ca851122c0f0f3d877ab9d8f4d.pdf d7f41254496faf410c74022619a48ae8 PDF Text Text . 7. .. .77... , . .7. W “ms 7.. ...,, . i “m: . «vy ..~ ... (3' ___,7,.,‘ m... “av-.mvn—pvmm ~ w: hmrnm. v. mw..~..r-w..—mu--w\ u—u- KMVv-uw-V . w- “WWW“. -. . w .~\.m-vw—~,.»v-‘—— www>‘>w' ‘w-v- “a .—.,...1_.... m. ,7 . A ”m, .v. m V. .—»- 1 i i E t E June 2, 1969 E l i I E S E E Dr. v. G. Longo Institute Superiore do Sanita Viale Regina Elena 299 Rom, Italy Deer Enzo, It was a pleasure to mxk with you in Rome and Liege. received the promsed summary of the proceedings You have by now E E E i l _» g g in Liege. In our discussions with Alex, and in Liege, I was impressed with the progress in the understmding of cmtnal neurolmnors , including the "Initiative" ores. For some tire I have been particularly interested in the CNS effects of re .eted grand-— mal convulsions (as in electroshock flumpy [ECT ) when I reviewed the available biodxemistry in 1959—60 and again in 1965 , I enpimsized dwlinergic molmisms because the data was available; and because of my special ecperiences with anticholimrgic drugs. Isupposeoneomldnekeasgoodaceseforcentml ECI’ as for dwlinergic. Perimps the time is right for some ackiitional study, and I am taking the liberty of sending some of w reprints in the hope that their critique may become the basis for dismesim. I would be particularly pleased to have you visit New York Bywaflxaninetic d'zanges in m. ~«Mwwm‘. . this fall; and want to take this opportunity to them: your hospitality. “an ‘ ‘ My best regards . Sincerely yours , rm Fink, 14.0. Professor of Psychiatry you for in». .mwnww-‘ . . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Longo, V.G. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-3-257 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e6aae868cc81368b7534c5a8f24d333e.pdf 82fe3fdeccad2a4ba25410dcb99fca4d PDF Text Text July 28, ~ av ., paw." :v. 11". V. G. 1969 ngo Institute Superim di Sanita Ram, Italy mfi-r‘w-V‘ ' , rs wrm yuaa' Dear Duo, will be pleased to have you pmaent your work to some ofmyassociatesmfiueZmd. Ilod<forwardtoseeingywin We California and then in New York. Sincerely yours , Fink, PM). Professor of Psychiatry Max MFflcp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Longo, V.G. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-4-393 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/dad05398cc38495ab771e954380aacf2.pdf fd2beeabd922a808d3822f7faa085977 PDF Text Text wmri-w- ,. m “.m- wwm. MIC-w n ww-w—aw-W ..-— nm—r—z—m-mwwm— , « ~m.~~---mn-~w.—————wv-V...u. Jhly .m..—.~u-——.w 4- V. \ w:”w rA<nVY7WI~vl—-wrnvw"wr—W 28 . 1969 Wewinbeplmodtohawywmmwwkmm dmyusocistosmfinnnd. Ilodcfmu'dmmingywin SW W: Max Fink, NJ). Professor of Psychiatry MPdcp v'rlrv y,” Wu;- � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Longo, V.G. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-4-399 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1354445ede6d5d85eb7cfca03edec300.pdf 7a836524935c1ca6a04c2344b2741693 PDF Text Text ' ‘ Wen'nfiv’n was. r. -v August 15, 1978 Docteur Henri Loo Paris , France Dear Docteur Loo, for your inquiry about the report on the which was presented at the CINP meeting in Vienna last month. The paper has not yet been prepared or accepted for publication, and cannot be cited in a review. mechanism Thank you of action of ECT However, there are a number of my more recent papers which you hay not yet have seen, covering the same material. These include: Efficacy and Safety of Induced Seizures Psychiat. l2; 1—18, 1978. Is in (EST) Man. ngprehens. a Useful Therapy of Schizophrenia ? In: J.P. Brady and H.K.H. Brodie (Eds.): Controversy in Psychiatry, Philadelphia, v.3. Sunders Co., 183-193, 1978. EST Myths of fiahock Therapy". Amer. EST: A spldial Io Case 235-29“. 1977. J. Psychiat. in Pharmacotherapy. In: ggg; 991-996, 1977. W. E. Faun et al. (Eds.): inlrnngggnnyof Depression, N.Y., Spectrum Publn., :1;. mu Wu; «runaway-“3,“.- In addition, I have written an extensive review of "A Sincerely yours, away law-w 17' ‘Wilm:rvml tamwm ECT will be published in January by Raven Press of New York, entitled "Convulsive Therapy: Theory and Practice". You may wish to refer to this volume when it is available in a few months. which Fink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Loo, Henri Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-029-3-118 Date A point or period of time associated with an event in the lifecycle of the resource 1978 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9f9a6e8c33027d33e81f6fa16f3ce1e7.pdf 543f682f0dd732a81f84eaa6219137a4 PDF Text Text July 13, 1984 Prof. Henri Loo Faculte de Medecine de Paris-Cochin 100-102, Rue de la Sante 75674 Paris Cedex 14 France Dear Prof. Loo, Thank you for your kind remarks in your letter of July 3. I enclose a draft of my report to the CINP -- but you should be aware that this is a reading copy and lacks the tables, figures, and references which a properly completed paper would include. You may use it for your outline, but I must ask that you not quote it directly. I suggest that you obtain a copy of my 1979 book, CONVULSIVE THERAPY: THEORY and PRACTICE, published by Raven Press. There has been much progress since then, and I enclose additional reports which supplement my book. You may be pleased to know that I will edit a new journal, CONVULSIVE THERAPY, to be published by Raven Press, which will appear early in 1985. Should you or your associates have reports which may be suitable for such a journal, I would be pleased to receive them. My regards and best wishes for the success of your efforts. Sincerely yours, Max Fink, MD. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Loo, Henri Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-030-5-121 Date A point or period of time associated with an event in the lifecycle of the resource 1984 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e3ca86791844e5581d52d7484b7aa70a.pdf d303f7247c39a5abc72e39d71c661960 PDF Text Text m... V"...we: November 2, 1979 Peter T. Loosen, M.D. Dorothea Dix Hospital Raleigh, NC 27611 Dear Peter. Thank you for the two articles, on the oral treatment of depressed patients with 80 mg TRH and the review of peptide effects. I had seen the Karlberg et al article, but in light of our discussion, I should be disappointed and assume that the likelihood that TRH over three weeks would be significantly antidepressant. Yet, the many observations including the three patients who responded in this series, suggests that we may be close, as close as the early workers were with l-dopa in parkin- son patients. For the meanwhile, I have decided not to replicate the study; but rather to try with two of the newer peptides, DGAVP and des-Tyr-gammaendorphin, to assess their central (EEG) effects. My associate, Yiannis Papakostas has been carrying out stimulation tests and dexamethadone—cortisol tests in every one of our depressed patients, referred for drug therapy or BCT. So far, in the first 15 patients, he has found more consistent DM-cortisol abnormalities which resolve with treatment, than TRH-TSH but the latter do occur in about 1/3 the cases, and he is confirming the observations of TSH blunted response in some depressed. He is using our schizophrenic patients as controls, and we are particularly interested in the ECT group. TRH-TSH It was kind of you to think of me, and my thanks. Sincerely yours, Pink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Loosen, Peter T. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-029-8-296 Date A point or period of time associated with an event in the lifecycle of the resource 1979 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c8b0b7126bea2aec4e1d7b92a77e1041.pdf c0d937b1c9fc6ef1b53b01a01a082bb2 PDF Text Text Jmuary 1h , 1966 « ,. r , ..— .v ‘.A...v<.,._ u_ . v (w... , q... . u, “aw." . : .17 qunmm WW, u- -; w -. mwllzmv-w' ”’Eu' m“, _, —.. mwr .7, g<.;,g;.r...m.— “.1” ;-—~rvnwl 2'. .mu. Mr. Rabat-t A. lam: Wratiw Salas Tram world Airlines, Inc. 1&2: [out Strut 3t. Innis, 2&8st 63103 Dam Kr. Lama: merymflnforpmvidingmwifiatho It is indeedahandoome mmaxImmted. Madurofflusewimuhidzmrxmbomsokind to pmidn auxin; the past to: years. Sincerely yours, Pink, ”.11. Executive Director Mm: MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lorenz, Robert A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-225 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b119c4e5b416fa01c1e717d4ba169702.pdf 65c567aaad35680b866b8494a80178d2 PDF Text Text March 19. 1953 Heuriee Lorr, Ph. D. Chief, Outpatient Psychiatric Research Lab. Veterans Administration Benefits Office Washington, D. C. Dear Dr. Lorr: I wenld appreciate receiving a copy of PBlO-SOY, the bulletin which describes the HSRPP as it was originally develoPed. I enjoyed your participation in the meetings in washington last week. Many thanks. Sincerely yours, Fink, Director Mex MF:ew M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lorr, Maurice Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-4-195 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/df587ba523368f086d136c0e259bf657.pdf d28fd4dab27782448570accf75440ed3 PDF Text Text August a, 1963 Loss Gates Dodge San Jose Califomm Gmthmm I to attain! the 9‘11, 1983. Septenber Jose. am plarming IBM Workshop in San I mix: like to make a memtion for the nigats of Summer 8. 9, 10. a 11 and hold for late arrival. Please confirm this mmwatim as seen as possible. Sincerely , Mf'uk Fink, ”0 m Mmctw Do. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Los Gatos Lodge Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-375 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/782f5ac43799492261267d606f02d95a.pdf 37ad10cc3321a39896770bc9dde4939c PDF Text Text T0: Dr. Alden Loud Graduate School, FROM: Max DATE: March 1, 1971 NYMC Fink, M.D. pleased to enclose a recent summary of our BEG profile analysis studies, as the basis for any recommendations you may wish to make in Westchester to IBM or other organizations. I am techniques are applicable to the Ocean Systems interest in "neurophysiological responses of the primate brain...”; and to IBM sales interest in the IBM 1800. Our ENCL. Mszt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Loud, Alden Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-3-254 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/75d62b2bc17cb0064a3c2ae247f74cec.pdf ffb0083fca4c39fd373ba6c21d2593a0 PDF Text Text mmmwm'w~'m“wj W T0: Dr. Alden Loud Graduate School, FROM: Max DATE: March 1, 1971 NYMC Fink, M.D. pleased to enclose a recent summary of our EEG profile analysis studies, as the basis for any recommendations you may wish to make in NestcheSter to IBM or other organizations. I am techniques are applicable to the Ocean Systems interest in ”neurOphysiological re5ponses of the primate brain...”; and to IBM sales interest in the IBM 1800. Our ENCL. MF:kt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Loud, Alden Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-3-260 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/33f990d3b1a288b3fd64a02ba2720115.pdf aa0a2dbffe8c8b64b5123df3bef9b93e PDF Text Text August 14, 1964 Dr. Lowoll Bolliu Director of Public Health Springfield, Moosaehuoottu Dear Dr. Bollin: Dr. Gerald M. Abraham. now of Tel Hood, Israel, and formerly house physician at the Chronic Diseases Hospital in Spring~ field. has opplied to the Institute for residency training in psychiatry. ptepsratory to a corner in the treatment of the severe mentally ill. He has auggestod we inquire of you ro~ gatdins his qualifications. would be grateful if you would share with as your recollections regarding Dz. Abraham's ability on a physician, his intellectual ability and capacity to undertake a now corner, and his personal- we ity as related to his patients and ¢o~worketa. I have just met Dr. Abraham and found him pleasant, friendly and ainoero. Rio wife appears dovotod. Bis reasons for turning to psychiatry are unclear. and yon: recommendations will be of help in judging his applicotion. Thank you for your cooperation. Sincerely yours, Fink, Diroctor Max MP/jb M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lowell, Bellin Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-5-569 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/03cee62af890c04e7f988de66af54fa2.pdf 3afdf94e92ad6d65841a4547c1ba14bd PDF Text Text April 19. DP. 225 New 1953 WI, Strut fr. Wt: Itwas aplemumtodiamayumsmdypmgmdufingny WI." H. D. East 70th York, flew York 10021 Dear moat visit to the New York Medical College. Your proposed convex-ism of imiprimine and as mutiv—dapmsamta is an interesting study. especially is misc! out in an mmpatiem“ populatim. chlorzmm if it mmmmmedalmsoaleoonnbomivosmdym In eight hospitals meantiva patients based on this report. Wis @13th to the institution with the of depressive disorder will be manly assigned to flame mamnt mocks , dulorprmazine, Mminim or plaoebo. The groups are now wader- tfldfiflwmolindmrystudiesmdetemedosagemgea em ontimmteesoflutfimivdnfinifiwmoanbecaniod out with the best and results. I was also-interested in your Dr. Freeman two articles on LSD momma-st and have wt to 1.8meij of drug addicts. I donotkmwifflmsewillintemtym,solhmsmtthemm tohimintlaewntflutflmiamwflmmuberofflnstaff who may find them of mm direct intemt. ' Good 1nd,: in‘your audios. Sinoemly yous, Max Fink, H. D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lowenkopf, Eugene L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-2-207 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0d68c1072067af5de480e5f7c89d96d0.pdf d26ed09698912657e891d1782bf18c9b PDF Text Text ”rum-‘— Tam-655 April 30. 1973 gyv—gmzmr . . 1, - ‘5‘mn’a7'w7—vy-Juew4’: , Ms. Linda Stein. Membership secretary. 250 West 57 Straw. Room 1201, 1!“ York, NJ. 10019‘ It is difficult for we to decide on whether my activities in the rmmmm your: V111 be in Suffolk a county, where I haw office. a: in Hanan County, I have my ham. I m not enthusiastic about making that choice at 131“ mount um, and fihoreforo where this ”quest for tmafer of membership snub a use an I «a Until magma. that decision, I with to resign from the Rev York County District Branch, without specifyim Mattie Branch an returning m Membership. Binenraly your: , Fm. “CD. m Professor of thu‘bry lit/13 Em . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lowinson, Joyce Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-1-039 Date A point or period of time associated with an event in the lifecycle of the resource 1973 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/19894aebdb72b94dd58f478eb58dfe21.pdf eb66343ce131d612a77e6945be66856e PDF Text Text Septembor 6, 1968 Dr. James Lowry Director, Dopsrtusnt of Mental 1500 Fifth street Sscrsnsnto, California 95816 Hygiene Dear Dr. Lovry, repott presented at the Hostsrn Institute was st our study units and presented in various papers. ooms published sod some in press. The most recsnt sunosry is that prepared for Dr. Phillipson's The a synthesis of dsts collectad volums on drug dependence. entitled "Antagonists in the Treatment of Opiate Dspsndsnce“. Additional reports are enclosed as background material. Thank you rsvidw of the for your interest LSD and for tho excellent and hallucinogenic problsns in California. Sincerely yours, v «A , Pink, M.D. Professor at Psychiatry Max v. .4 ”—2,;- .v'v’ V'Wv‘ltw‘”.-qw:m"filw;nvrrvyz'JVa*-' w v,» ml � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lowry, James Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-5-509 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/78b547c9460052c87ec665bd7bfab3e5.pdf df6b8b1e4378c612a7d402aa85bf7187 PDF Text Text v.-.~ r.-. .— -.W......_-_ r-<~ A Vanna—w ’4) April 27, 1972 Dear Turan, KBknel's observations of a definte relationship between marijuana use and hard drug use should be reported, if the data is indeed good. To my knowledge, there is no satisfactory of any causal relation between the use of these drugs; they are often combined by propinquity. The issue of causal relationship has been reviewed by the Commission on Marijuana in its recent report (1972) and by the two reports of the Surgeon General to the Congress on marijuana use—— 1971 and 1972. ypuucan imagine, defining a causal relationship is and I doubt that KBknel's data is much better than that ,presented before. Should you be convinced of its merit, is eminently publishable. Perhaps, you would write to Leo Hollister who is organizing a marijuana session at the CINP and he may give KBknil most As difficult, it some time. Don came back from his visit all enthused with the fine data you are getting in Copenhagen and in St. Louis. work ! My best regards to Ellen. Max Keep up the good � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Ltil, Turan M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-2-198 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e2d7a22f21884846bbe1085701fb03a3.pdf ee90b6636a2939c431e9eff56d3ec7e7 PDF Text Text February l7,ol96k Dr. Ardie Labia Dept. of Clio. & fioclol Psychology Walter Reed Army Institute of Rooooreh Waltor Rood Army Hedldol Center Waahington, D. G. . Don: Axdlol Some months ago, no not in John Stoxn's room in Washington whoa we were all attending a mooring. At that time, I had that you were planning on oomlnz to St. Louis but since then the rumors in the city are the: you will bo joining Dr. Anthony this fall. 'Congratulatiooo! no knowlodgo I have found tho move to St. Louis was: stimulating, and tho resourch opportunities horn are oxcollenc. I-troo: that your laboratory will grow rapidly.» My-ansociatos and I would ho pleased to have you trips to St. Louis. Again, my visit with no on one of your best wishes for success of your program. Sincerely yours. Fink, Dlrootor Max PIP/1h 14.!) o � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lubin, Ardie Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-1-142 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/73b57df4434b4613c7c7471a4dbd5e95.pdf 380631ef66619701db829c4c61ff03d2 PDF Text Text .F, ..W—.—.Ar m,‘ .. .v-. _ N, V ‘w._ “wav—JWD February 17, 1966 wwwwwww, "— Dr. Arflx‘ Labia Dept. of Clln. & Social Psychology Walter aged Army Inttttuta at Rauaarch ‘WQIter Rand Aruy Hadicnl Cantor Washingcan, D. 0. WWW unwn—n-mme—w— Dust Axdicl Sana months ago, in In: in Jahn Stern's roan in Washington when at vote all attending a amazing. At that tint, I had no knowlndgn that you V!!! planning on mowing to St. Louis has atacc than aha rumors in th: city are that you will be joining Dr. Anthony this fall. Congratulations! I have found tha nova to St. Louis Host stimulating, and the rcluareh opportunitias hcra are cacallenc. I :tust than your Inhoracory will grow rapidly. Hy annociatcs and I would be plaalad ta hava you visit with us on one of you: crtps to St. Lcuiu. Again, aw bcot wishes for auccann a! your yragran. Sine-taly years, 13“ Fink, 3.1) o mwvwm- ”mmvawmm—WWWsW-ww—mw:m - Dirnetor HP/jh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lubin, Ardie Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-1-146 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3fb900a331666c02ac75e069783f0d41.pdf defb55f10f5444ed1e3f7cc02bc8e0a1 PDF Text Text July 16, 1968 Dr. Ardie Lubin Research Psychologist Navy Medical Neuropsychiatric Research Unit San Diego. California 92l52 Dear Ardie, It was kind of you to send me the preprint of your effort in discriminating sleep stages. It represents latest much work to read it. since I have just revised the paper of our period analytic approach to the same problem, following some suggestions from the editors of the EEG Journal. The revised version is enclosed and represents much of the data from the Missouri laboratory, exce t that there are additional tables such as you request spage l6§ describing the relation of the computer classification to the visual by the trained observers. This data is being prepared for another publication. but I am sending your preprint to Dr. Itil with a request he share the data with you for inclusion in your report. and I appreciate the opportunity I am impressed by the portrayal of the power spectral density approach, especially by the complexity and by the implicit expense. difficulties which you describe - difficulties which are described this approach. and also found by ourselves - are the lack of discrimination of small differences in this method. The by others trying Perhaps the lack of discrimination is related to the paucity of samples for study ~ if I understand, you analyzed l8 selected minutes of an all night sleep recording. This small sample is related to the cost of power spectrum. That PNRS shows good discrimination among sleep stages by the delta band, the unimportance of theta, the significance of alpha and sigma, and the difficulties of discriminating stage I from stage I-REH and stgge 3 from stages 2 and 4 are the same problems we faced in power spectrum. Additional discriminations are possible in period analysis. for the stage I - stage I-REM discrimination is now available; the stage 3 discrimination is feasible following your suggestions (page l8) and some of our own. �Dr. Lub1n Ju1y 16, 1968 -2— Some of the I agree w1th your conc1us1ons (page 17). recommended add1t1ona1 data 13 ava11ab1e or 15 read11y programmab1e us1ng per1od ana1yt1c and the d1stance funct1on ‘ approaches. Perhaps the t1me has come to compare the ava11ab1e methods for systemat1ca11y co11ected data. As I 1nd1cated ear11er, we are prepared to ana1yze tapes us1ng the per1od ana1yt1c methods. We wou1d be spec1a11y 1nterested 1f they are a1so to be ana1yzed by)our methods. The costs 1n do11ars and t1me are negot1ab1e and shou1d compare favorab1y w1th the expense and delays wh1ch you descr1bed for your present systems. Such ana1yses cou1d be done as part of a demonstrat1on for an APSS meet1ng and as the bas1s for a d1scuss1on of the ava11ab1e methods. If th1s is not feas1b1e, we wou1d st111 be w1111ng to cons1der a demonstrat1on for you at a cost that 15 comparab1e to that of Astropower. It was a p1easure to hear your report 1n Wash1ngton, and to read th1s prepr1nt. Perhaps the enc1osed report W111 perm1t you to be more opt1m1st1c about th1s rea1—t1me (or 2-4x rea1 t1me) ana1yt1c system for the re11ab1e and automat1c scor1ng of EEG sleep stages. My best regards. S1ncere1y yours, /flax F1nk, M. D. Professor of Psych1atry Mszp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lubin, Ardie Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-3-263 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f477ccf901ee0d4308f9778185d656b9.pdf a3ab1c5ee0c638e8b811dcb3154dba2e PDF Text Text July l0, l968 Dr. Ardie Lubin Research Psychologist Navy Medical Neuropsychiatric Research Unit San Diego, California 92l52 Dear Ardie. It was kind of you to send me the preprint of your effort in discriminating sleep stages. It represents latest much work it, since I have Just revised the paper of our period analytic approach to the same problem, following some suggestions from the editors of the EEG Journal. The revised version is enclosed and represents much of the data from the Missouri laboratory. except that there are additional tables such as you request (page l6) describing the relation of the computer classification to the visual by the trained observers. This data is being prepared for another publication, but I am sending your preprint to Dr. Itil with a request he share the data with you for inclusion in your report. and I appreciate the opportunity to read I am impressed by the portrayal of the power spectral density approach, especially by the complexity and by the implicit expense. The difficulties which you describe - difficulties which are described by others trying this approach, and also found by ourselves are the lack of discrimination of small differences in this method except at a great expense in either time or dollars or both. — That PHRS shows good discrimination among sleep stages by the delta band, the unimportance of theta, the significance of alpha and sigma, and the difficulties of discriminating stage I from stage I-REM and stage 3 from stages 2 and 4 are the same problems and the same discriminators we face in period analysis. Some additional discrimination: are possible in period analysis, for the stage 1- stage I-REM discrimination seems now to be working; the stage 3 discrimination is feasible following your suggestions (page 18) and some of our own. �Dr. Lubin July l0, l968 -2— conclusions (page l7). Some of the data is available or is readily programmable using period analytic and the distance function I agree with your recommended additional approaches. Perhaps the time has come to compare the available methods for systematically collected data. As I indicated earlier, we to are prepared analyze tapes using the period analytic methods. We would be specially interested if they are also to be analyzed by our methods. The costs in dollars and time are negotiable and should compare favorably with the expense and delays which you described for your present systems. Such analyses could be done as part of a demonstration for an APSS meeting and as the basis for a discussion of the available methods. If this is not feasible, we would still be willing to consider a demonstration for you at a cost that is comparable to that of AstrOpower. It was a My best regards. pleasure to hear your report in Washington, and to Perhaps the enclosed report will permit ou to be more optimistic about this real-time (or 2-4x real time analytic system for the reliable and automatic scoring of EEG sleep stages. read this preprint. Sincerely yours, Max Fink, M.D. Professor of Psychiatry MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lubin, Ardie Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-3-269 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/64f5a293e067a8d1fe714f6671a50112.pdf c5fc5465e72549cc3c3eacdfd94c4345 PDF Text Text June 27 , 1987 Br. Arthur J. Lunny Chart Paper Sales Grass Instruments Quincy, Massachusetts 02169 Dear Mr. Lonny: for will be receiving an order following the teleprxme quotation copy of the order is enclosed so that you h the regular channels you 100 packs of EEG 30~8"-WROR of $3.25 per pack. can anticipate it. A Because of storwe problems , I would be grateful if you would ship us 25 packs and holding the reminder until notified by this office. Would you bill us for the total amount imnediately, since that would be easier than billing at other times. I have rarily used imprinted paper, but perhaps for this new Department, it would be helpful using as small a type as is reasonable. I would like to have the paper imprinted on a single line as follows: EEG and iiuman Psychopharmoology ~ Department of Psychiatry me appreciate your settling the as soon as practicable. first I would NY . shipment of 25 packs Sincerely yours , Wm. M" .,,, VIM-w... Fink, M.D. Professor of Psychiatry ...V Max .. , wm-4mfiyvef-(¢.w.qwf MF:kp Medical College before hand, I would be sanple of the type could be sent to pleased. If not, go ahead. If a ~— � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lunny, Arthur J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-021-5-233 Date A point or period of time associated with an event in the lifecycle of the resource 1967 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/be9968dc465e4c04974022a0f12ed368.pdf c7b6f30899d6ceb208e237f70bb9be9c PDF Text Text my-w' wwwvwwisz—m July Mr. Arthtm J. 12 , 1967 Lunny Chart Paper Sales Gmss Imtnment Quincy, Massachusetts 02169 Deaer. bunny: We The order No. loullu has been signed and should arrive within the next few days. Ehcloaed is the contract requested. If you cannot ship 25 packs of the imprinted before production is shut doom, please send me mfimprintedpaper for paper the first order. Please send me a statement for the full annunt due for plus the additional service charge, assuming them will be shipmmtsof 25 packs at a tim for the reminder of 100 packs the contract. Shmrely yours , Fink, M.D. Professor of Psychiatry Max MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lunny, Arthur J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-021-6-369 Date A point or period of time associated with an event in the lifecycle of the resource 1967 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1d8593d184a78f96914211deb4878a3e.pdf fb2c0f66e4c3b7b04f91de0789e1db54 PDF Text Text January 8, l968 Arthur J. Lunny Chart Paper Sales Grass Instrument Company Mr. Quincy, Massachusetts 02169 Dear Mr. Lunny: boxes On our outstanding oeder of to my new laboratory. EEG paper. please ship 25 Dr. Max Fink Department of Psychiatry Metropolitan Hospital, First flew Separately December 29, we Avenue at Room l5A9 97th St. York, New York 10028 are sending you an additional order, dated 100 boxes. Please bill us promptly. for another Sincerely yours. Fink. M.D. Professor of Psychiatry Mex Mszp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lunny, Arthur J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-1-138 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b64d03439a33ea822fce09793be42d30.pdf 60fa55e86b61ee59b8e7e6f6dedeb4ef PDF Text Text -~-vVI'”FA.-7'I(4— ,,. ..~—..\....g.. , r'wvuw- "W“; gm. .—..—~..r; ,‘mw— z-Wm—q-q—‘vw-“aw—Amean». gawk-m.» .m .~-.—’V"r .. _ :, ... in,” N 73 oaffl/ 73N-od8m ‘ January 5. 1973 Mr. Arthur J. Lunny Grace Instrument Co. Quincy, Massachusetts 02169 Dear Mr. Lunny, Thank you for clarifying the remaining order for EEG chart which I have with Grace Instrument Co. In the ensuing weeks, paper my staff will call and ask that the remaining boxes be shipped to one of my two laboratories, at the New York Medical College, or Building Surge I, Room 2310, Health Sheencee Center, Brook, Stony Brook. flew York 11790. that are result of our split shipping. charges end service charges H g 5 , We SUHY at Stony will defray all shipping due or may become due no a With regard to purchase order 516318 dated 11/29/72, I have asked the purchasing department to cancel the item #2, "50 packs EEG paper. 10", at 3.75, $187.50"; but to retain the other 3 items, for electrode cream, pens, and IF 100. If not yet shipped, I vould appreciate your sending these items to my attention at: Department of Psychiatry 5 East 102 Street New York City 10029 I em most grateful for your cooperation, end wish your associates the beat of health and success in 1973 l you and Sincerely yours, Fink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lunny, Arthur J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-7-584 Date A point or period of time associated with an event in the lifecycle of the resource 1973 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/45cc2474f6ddffe636d54d9e508b1d39.pdf 4df24c900b5b34caa84c44b0497f7787 PDF Text Text November 20 , 1961+ Dr. and Mrs. Jacob Lustig 36 Jaffa Road Jerusalem, Israel Dear Dr. and Mrs. Lustig: visited you It has been many months in Jerusalem and yet events of yesterday. have talked of little It was it since my seems as family and I clear as the a wonderful visit, and else than our trip. we am enclosing a copy of the book that inPlease accept this as a mnefito of our visit. terested you. I When I returned to New York, my mother and had the opporttmity to visit V father were excited that I'd I hope that in the coming year they will plan a trip to Israel and have the opportunity to renew their friend- with you. ship . regards. Martha and Jonathan join in sending our warnest Sincerely yours, Max mfgls e nclosure Fink, Director M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lusting, Jacob Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-7-783 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/fe91b18542fbd3fa0a41cc39c6aa4628.pdf b331dbc5405ca1504ad1c56e0c0cc110 PDF Text Text May l0, l968 0r. Marguerite Lynge-Larsen Drug Addiction Treatment Center New Jersey Mauro-Psychiatric Institute P. 0. Box 1000 Princeton. New Jersey 08540 Dear Dr. Lynge-Larsen: Enclosed is a copy of our presentation at the American College of Clinical Pharmacology and Therapeutics and two other reports from our addiction program. I trust these will be helpful and additional service, please write. if we can be of any Sincerely yours, Fink, M.D. Professor of Psychiatry Max MF:kp enc. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lynge-Larsen, Marguerite Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-2-152 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5ac14f8d13b1bee9aa2b48bf1d39b550.pdf d3e7f9c60d6ce35a91d8483e255be094 PDF Text Text May 21, 196:; Mr. Waynn Lewis Lym 12 Kresge Street Wilkes-Barre, Pamsylvania Dear Mr. Lym: Wemuldhopleasedtoappointymasfiedioal Labomtmy Technician II, to tho staff of the Misscmri Institute of Psymiatty, affective an or abmt 195% at the rate of $388.00 per month. Jm 1, , Hissflmxyhashighlymmndedym,and1 am locking forwaN‘ to your joining the staff. Sincerely yours, Fink. Bumrtive Max H. D. mmtor � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lynn, Wayne Lewis Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-4-393 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/dcb1de98d57a020baf2083e9d5ee7f94.pdf e81fa7b952646fe6dab5b3bea4eb7529 PDF Text Text March 19, 1977 Mr. Robert Lyons York Academy 2 Est 63 Street New New of Sciences York City Dear Mr. Lyons, I have received a large number of reprint requests inquiries regarding the purchase of the volume 282 on Chronic flannabis Use. I am writing to ask whether the Academy has printed descriptions and purchase order blanks for this volume. If yes, I would appreciate about no copies. These will be sent to the requesters with the reprints that are available. and Parenthetically, I recall that our agreement the editors would receive 3 copies. 5 was that copies of the volume. I have received I hope the volume is well received. From the reprint requests already in hand, I would say that the interest is quite high. Sincerely yours, Max Pink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lyons, Robert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-5-241 Date A point or period of time associated with an event in the lifecycle of the resource 1977 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d2732091ac520d9f4caa42e87f53c925.pdf 9692ff5a4dad61eb5f7e83c8934ccc84 PDF Text Text Oetdher.25th, 1912 7 ; :. 3:16.13 'fé We]. Hm. 11378 mamth, 3155.3, 11.2.- tr: 7M Enelniad ghrao stamamants tram IBM regnré1u TM'ifag mgfiuytn1“ssent torlnu.oa our bohn1t. to be used __,_ ,1_.: “9%,! the IBM 1800 system tram New 7 to thnM,3tste Eh1vars1ey at new York fart at anpraeiate ynu rind1ng these " ' _ Jiver1ty1ng thair receipt. MWMMVV ” to seeing ‘er 2nd. you at ' 10 o c1aek on . . Sinaeinly yours, 'Mh: Fiat, M.D. Professor of Puyehiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Macken, James Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-4-283 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a29f6f870d2216ec0e5adc1148f42467.pdf 5efe99ec58655dcb6aa2e4ce9ebfadc6 PDF Text Text January 21, 19614 W3 Hr. Lodxgilptnad Mum, muslin Scotland m6'. D. Lo Daar Dr. Hadcenzie: Dr. J. of Lanaashim has indicated an interest march psychiatrist at the Mimouri Institute C. Holden in an appointmnt a warm as its Wandmihing mentally ill. and Mines both of Psydflatry. This clirfioal principal few; studies in the clinical and laboratory . w elecuwoenoaplmlogmmm an new operational. I 3am Laboratories clinical paydmology and «was mummm in r ' - would be grateful for your opinim mgazding the reward": Ir. Holden. as wall as your estimate of his ability to abilities of mm. participate in collaborative Many thumb for your cooperatim. ‘ Sincerely Max Firm, mmctcr Mfsmlg yam , M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mackenzie, D. L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-1-058 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6bd1554506f42e88357bfc3053d5464e.pdf c45c26b3b95254598b1e84de2e9b13ec PDF Text Text , ll?“ May 15, 1992 Ellen P. MacKenzie, MD. 2216 Belle Chasse Highway Gretna, LA 70053 Dear Dr. MacKenzie, very much appreciate your letter of May 5. am heartened, rather than discouraged, by your plea to use my influence and reputation to enhance the education of your colleagues. You represent one of those who came to a course, and are now using your skills to treat patients who need ECT. That is gratifying enough. I I gave a lecture on ECT at the Ochsner Clinic. They sent a to my laboratory for a week. And while have not Heinz, trainee, Jerry young heard directly from him that he has begun to treat patients, another resident introduced herself at a recent course and said that they had begun an ECT unit. Last year, I I The best can do is visit again, if the professionals at Charity Hospital seek some help, either in teaching or in organizing an ECT service. But the need must be felt by the professionals at the facility. I I believe we are making progress. The case reports published by Sandoz are not meant to educate, but to indoctrinate. So long as medical schools and psychiatric organizations depend on the largesse of industry, they will be subject to this type of ’education’. Gilbert Honigfeld is poorly acquainted with ECT, and has no interest in any comparison bevvteen clozapine and ECT. When clozapine was still ’experimental’, proposed to Honigfeld, Kane, and Meltzer a study of their treatment failures, i.e., the 70% of clozapine treated patients who did not improve, with ECT at no extra expense to the patients. But we never received referrals and only recently have Meltzer and Kane begun trials of ECT with clozapine or after clozapine. I Good luck in your efforts, and many thanks fgor your kind remarks. Sincerely yours, Max Fink, MD. Editor � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: MacKenzie, Ellen P. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-033-1-017 Date A point or period of time associated with an event in the lifecycle of the resource 1991 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c3d8b9ff9416e54495ac766a2b8532b1.pdf 8b6d4d8b9f8bc60859c20e483200f755 PDF Text Text W new 31, 1953 Mr. K. Wtchie Registrar The Boss Clinic Oomhill Road Aberdeen Scotland Dear m Wtchie: 'mmk ya: vary such for your inqmdxy. The Hissami Institute of Psychiatry is the MGM am! twining comer of the Division of 1982, with Disemes of It was established inAtOctober, the time, laboratory md clinical facilities for mam-ch. WM: £033 70 Luminaries 150 of march beds, we are utilizing mm. mm mm. WWW, Why, Gunter for bath statistical and analysts. War Mmisaapccialimdpsydfiatdomlibmxyasamtpm am established in as well as a of the Imtitute. paydnlow, and Animal In additim, them facilitias an now being BBQ built. is a fully qualified three-year psychiatric at the Institute, and a spacial twining prothus research mm in clinical Manley is being «magma. Both in programs and in the mining prom, tbs Institute is affiliated with the Department at Fwd-11am of washingtm mimity Samol of Madicina. Atflxepmenttime, progress. These include Lithim w a trump); for amid; the use of Yohimine as a pmdpitmt of midst)! and the devalmnt of antianxiety amnts; mlatim of ms patterns mad organic factors in the residency training program unmamrofmmmmin mar analysis of the treatment of trampy resistant psydxotics; wimdzuaal m beluviar in the cleatxmptmlom; the effects of «mg Manny ill; and the tmmt of psycmtics by therapy. m mlatmmhip �K. Mackitmic 31, 1963 War Tm' Page Wm: tannimtuofthaImtitute. MW m. may mtal or for min within Itismrmtmtoprwidetowmtha Institution few scientists appointed am availabu for at m with exAppoinmnta am made at salary lamb w ta with perience a minim salary being $12,000.00 per- mmm. In addition ta march aatisfactozy mimic: of. the {PM is mimd heavily in the dutcminatim of salary. Satisfactory camplatim of the acme enmination with either a twenty or artifimte is prerequisite to appoinw't. a». swam, mt I am enclosing a 1962 description: of the Institute. If this oppoztunity interests you, I would appmdata a eopy of your unwieulum vita listing your admtiaml and Nominal In exporianaa. addition, a snail phatmph and tin was of at least two mmwy mfm tom‘s. maywrito would be met helpful. Sincerely Mm: Fink. Director Mfmlg Ema. 1 mm. H. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: MacRitchie, K Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-9-671 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0203b44849c8616f2734ef9a1afc941d.pdf 4a478b214324d5018e6223a3897161f4 PDF Text Text 9W State University of New York at Stony Brook School of Medicine — Department of Psychiatry Max Fink, M.D. Professor of Psychiatry PO. Box 457 St. James, New York 11780 Phone: 516 4442929 516 862-6651 September 21’ 1993 Fax: 516 862-8604 Mr. Marty Madison Quest Publishing Co. Brea CA 92621 Dear Mr. Madison, Thank you for sending me the DHEW announcement in the Federal Register regarding the FDA classification of Cranial Electrotherapy Stimulators. Yes, these devices are the same as we assessed in the early 19605. It was the reports of RB. Smith in the 19805 that led the US. Army physicians to examine the advisability of reimbursing CHAMPUS personnel for such treatments that led to my review. My library contains two volumes which cite such research. Reynolds DV, Sjoberg AE (Eds): Neuroelectric Research: Electroprosthesis, Electroanesthesia and Nonconvulsive Electrotherapy. C.C Thomas, Springfield, 1971, 466 pp. Wulfsohn NL, Sances A. (Eds): The Nervous System and Electric Currents, Plenum Press, New York, 1971, 171 pp. Another set of data can be found in the literature of convulsive therapy under the term 'subconvulsive shock' or 'nonconvulsiveelectric stimulation' or 'electrosleep'. A good source for such experience is to be found in two old texts: Alexander L: Treatment ofMental Disorder. W.B. Saunders, Philadelphia, 1953, 507 pp. Kalinowsky L, Hoch P: Somatic Treatments in Psychiatry, Grune & Stratton, New York, 1961 [or earlier editions]. I would like to read your report when it is published. Thank you for keeping me informed. M Sincerely yo Post-lt‘" brand fax transmittal memo 7671 l#of pages > To From xy “/ka Map/lam ‘1 Dept Fax"7/4 525 5257— C, Max / kw" PM“ #974 +144 PM 574— 4514 ‘ / 29% 7534 3, Max Fink , M.D Professor of Psychiatry and Neurology . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Madison, Marty Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-033-3-057 Date A point or period of time associated with an event in the lifecycle of the resource 1992 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/28ff1989f4979ccb3b1c026a9fbd9a3a.pdf 57f65782f8b3a18ef8465d2ca361c235 PDF Text Text October 14, 1968 Mr. John Haher Bureau of Narcotics and Bangerous Drugs 633 Indiana, N.W. ~Room 510 Washington, 0.0. 20226 Dear Mr. Maher: Thank you very much receive a letter for your c00peration. You should from fir. Harold Slumberg of Endo Laboratories. Enclosed is a capy of the report submitted to us by Dr. Schwarzkoof regarding the analysis of the heroin recentiy sent to us. Again my thanks for your cooperation. Sincerely yours. Fink, “.0. Proféssor of’Psychiatry Max MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Maher, John Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-5-428 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/fd61301d7d8fd8dcd1de58bfe3d13593.pdf bbe50b12f89d5fce5be0ed2fac61a8b1 PDF Text Text November l8. l968 Hr. A. Mahmood Managing Editor The Pakistan Medical Review 505 Quamar House, Bunder Road Karachi. Pakistan Dear Mr. Mahmoud: Enclosed are two capies of our report "Psychoactive Drugs and the Alert EEG" Medical Review. to for publication in the Pakistan its publication and would appreciate receiving a capy of the Review as well as the reprints you ‘suggested. I look forward Sincerely yours. Fink. ".0. Professor of Psychiatry Max Mszp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mahmood, A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-6-607 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/930ae2b958506cfc97d18d848431d52c.pdf 5329734f1d85b89c3a8a3550247ae1e1 PDF Text Text Septembea 1, 1968 Ma. A. Mahmood Phhiotan Medical Reuimm Kamchi, Pakistan Dena Mn. Mahmood,' Thank you 60& you& bind in the special edition the Pahiaxan Medicot Reuiwm. I do not know goua fouanaz, ozonextabzy, and.ao 51nd digfiicutt to know if the monk we have been angaged in wouzd Lntenaot youn neadena. Pemhapo a ££At of tho confinibuxnno to the volume it In the event that doeo Lntnneot you, I «outd be oend paepaked to you an «dilate entizzzd, "Paychoactive Dnugé and the Aleat EEG”. It £5 apnaoximazezy 20 paged in £engzh, doubfla apaczd; uuik.50 neéeaenczb; and adom 3—5 tabled and 5~8 giguaeo. Such an atticta could be paepaaad by the and 05 flczobam. I own-,1 vr m‘w - .w-J— wouzd appneciatn knowing the numbed 05 conLeA 05 the Reuéuo,.nep&£n£5 and honoaaazum which authoao may aecetoe in pamtécépation In thio vozume; in add£t£on to the Eiot 05 inufitad conznlhuzoaa. Thank you again 504 gout thd £nvi£at£on. flincemezy gonad, Fink, H.D. Pwofieoooa 05 Paychzatng zhxx Pineatoa, Divialon m“! -Hn' it mould be 05 help. 1:- .:-‘='AV,'aI'-‘.r'~ invitation to pantietpate on poochiatng 05 MF/ 06 PAgchoohaamacozogg � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mahmood, A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-6-609 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/388833064c85face6682be628a725f03.pdf 5d0624ce5a1f8e237a3fc38b2d189e6e PDF Text Text r-«ar-x—rwm an. “an“: uhmwzwmm-vvw’fl'fiufitwfl'r a -w-Iva~.‘:".w .4 -wn;.~‘\<’-' .-.u .—.- If”: we we. “mu-w ~ ; *’:'flw¢w‘(~w v" —— -- <v-Vvvm'mdpbfiluu‘w'fi'gmw- era- A A warn—v." - r Wk-w "WW—«mwmvm—w November 18. 1968 Br. A. Mahmood Managing Editor The Pakistan Medical Review 505 Quamar House, Bunder Road Karachi. Pakistan Dear Mr. Mahmood: Enclosed are two copies of our report "Psychoactive Drugs and the Alert EEG“ Medical Random. I look forward receiving a copy of suggested. to for publication in the Pakistan its publication and would appreciate Review the as well as the reprints you Sincerely yours. Fink. M.D. Professor of Psychiatry Max MF:kp ‘7'?er «ar “—3-: ..-.-~» “Mm-{w-‘n'nwt . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mahmood, A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-6-611 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/31425693a186b563965e1c4c0a71c49d.pdf 8b7943a3bd6d852317f2578d8c7f48a6 PDF Text Text Kay 1. 1969 Dr. Ra Pa “nickel Aaaoctaca Proton-or of Pharaacology Laboratory of Payehopharuacology Indiana Untvaraity Paychology Building Bloc-ington. Indiana 67401 Dear Dr. Haickalx Thank you vary such for your invitation to aarva on the Board of Con-ulting lditora for tha Jouanal 06 Behaulonal 9y. If I can ha of any halp in launching your purpoaad nan journal, 1 will ba plaaaad. Goad 193k. Sincaraly youra, “I! Pink, Hana Profaaaor of Psychiatry Hrtkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Maickel, R.P. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-3-317 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a5df84c0f4c47df6a13414a4c019d83e.pdf 563150730d069e3e0712d2c76d9e98e5 PDF Text Text May 1, 1969 Dr. R. P. Mbickel Associate Professor of Pharmacology Laboratory of Psychopharuacology Indiana University Psychology Building Bloomington, Indiana #7401 Dear Dr. Maickel: Thank you very ouch for your invitation to serve on the Board of Consulting Editors for the Joulnal 06 Behavional PhaAMacotogy. If I can be of any help in launching your purpoaad new journal, I Good will be pleased. luck. Sincerely yours, Fink, M.D. Professor of Psychiatry Max MFskp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Maickel, R.P. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-3-321 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/194a8a53939d4b3aa7722f056d45894e.pdf ba4469796deb5d399f3090a7ef8d46f1 PDF Text Text _ :wn‘r‘ w—wuwr-Mu'ww"r'\fi._'.~'v ~ "¢i\y~ Y u. .ww u. ~.'nww«v—,- .mp1..-«,;w,,m-rsr.v~g.w,...,.,.Vin. ,, November 5, 1969 Dr. Roger P. Maickel, Ph.D. Professor of Pharmacology Indiana University Medical Sciences Program Hall, Myers Room 360 Bloomington. Indiana 47401 Dear Dr. Molokai: as a for your invitation to articipnto of the new journal Mouton anmacology editor consulting Thank you fiery much and PAychophanmacafiogy. The only potentially suitabla manuscript on my desk now is enclosed. ”Electrographic Effects of Diacetylmorphino (Heroin) and Naloxone in Man" was originally prepared for the Bnizébh Jouhnat 05 Addictionb, but I would be pleased to have appear in a new journal. The subject of heroin addiction it and its treatment with naloxone is an important research issue today and we would like to have this material appear within a reasonable time. May I ask that have your decision within six weeks? t Again, my thanks for your kind invitation. Sincerely yours, Fink, M.D. Professor of Psychiatry Max MF:kp CDC. .. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Maickel, Roger P. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-6-633 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/33443bdad4597a389f65a18eca5740c5.pdf 8fbd11c4501d61af82205bcd2cae05a5 PDF Text Text «v.- 1: oz:- Wm t5" saw-wave «w vmmpa'u'wl January 14, 1970 Dr. Roger P. finickel, Ph.B. Professor of Phsrmacology Indiana University Meéical Sciences Program Hall, Myers Room 360 Bloomington, Indiana 47401 Dear 9r. Maickel: sent a copy cf ”Electrographic Effects of Diacetylmorphine (Heroin) and Haloxone in Man" for your consideration for the new journal figggppharmacq}ggx 0n November 5, 1969 we and Psychopharmacolqu. must be very difficult to liunch a new journal. Nevertheless, we would like to ask whether this manuscript It is acceptable or whather Thank you again we should submit it elsewhere. for your invitation. Sincarely yours, Max Fink, M.D. Professor of Psychiatry HF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Maickel, Roger P. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-1-033 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/769f27dd4b0165c75bd4083ff6b67bb0.pdf 087a8b95c54e5478680584951dfdd611 PDF Text Text MEHORAHDUE march 15, 19 72 TO: Mrs. Ebert F3024: Dr. SUBJECT : Painting Max -- mint-none. Fink '\ We paintadhgi appreciate having room 42A and \ tow days beginning be for a free laboratories will Lab 62A would \15‘. The butch 28, to finch 31. He would like it to be painted a lightlz tinted blue. Charge 89-21043 . ‘t \\ \ ».\ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Maintenance, Ebert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-1-048 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/18933ca8287a8b4db8bc458f07c6b52d.pdf e2954a15bdded2e0bd4674f183c29ab7 PDF Text Text Haven MI October 15, 1963 mm mm 1300 m Dr. Circle mm Yak 19. M 10 mm». N: Y. W: I m looking toward to seeing We «made 1963. you on mundey, October 2%, reservation the Clayton Inn for you for at a the night of October 23nd. I will be home thet evening and ifywwilleellmmyouemive.wemu1dbachlimted to have you visit with us. Sincerely yours . Max Wtw PM, Dim Me Do M579 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malamud, William Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-7-488 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4d15bf9b3e0708a93a07758833905117.pdf 6aa449175d10c611d38bdb02c7ce4e8b PDF Text Text . wow-pv- , w—m “we—“rm.“ “unwan-ntv WWI-“1”,”. —A'rI.-‘ February 6, 1979 Barry Maletzky, M.D. Portland, Oregon 97202 Dear Dr. Maletzky, Your letter of inquiry relating to our experience with the MECTA and with MMECT was referred to me fbemreply. As you know, I visited Paul Blachly in Oregon in 1968 and undertook a series of confirming studies of MEOT. The publications relate our experience, which was not good. In 1976, we purchased a MECTA instrument. In our initial treatments, we were unable to achieve a grand mal seizure using maximum current intensity and settings. We called the manufacturer, returned the instrument as he requested, and it was returned to us, with the assurance that a faulty part had been replaced. We again attempted to induce seizures and could do so at the maximum settings. When we attempted to use unilateral electrodes, we were unable to achieve the higher currents needed for such inductions. Gradually, the therapists replaced the instrument and when it was no longer useful, it was shelved, where it remains today. In the review of which was undertaken by the MECT (among other modifications of ECT) Task Force on Convulsive Therapy, we were unable to find systematic data which would assure us that this modification was safe or more effective than routine ECT, expecially with unilateral APA electrode placements. Our conclusions are cited in the Task Force report, #lh of the APA reports, dated November, 1978. In my own review of ECT, which is in press and which will be available by the end of the month, I come to the same conclusion, that fllfll indications for MECT are unclear, and further study is necessary before its role in treatment is defined." In that statement, I am being kinder than my real feelings, which are that MECT the little Justification except as a research tool. acquainted with your very interesting report on the outcome in ECT, as published in the issue of Comprehensive Psychiatry. I have cited the report in I am relation of deizure duration to latest �MuetZky, wv. BoMo Coco-ell... FGbrum 6, 1979 ocean-000.co- page 2 review, and find your conclusions most useful. The possibility of a therapeutic window for ECT is an important concept, and is consistent with the experiences reported from my laboratory by M. A. Green, who found that the duration of seizures changed with treatment,and that thresholds usually fuse. But we were unable to define a ’window', my but then we didn't have the concept. With regard to the MECTA, there is need for better ECT, and perhaps the unidirectional brief stimulus approach recommended by Lieberson in the 1950's and lately by Weaver is the way to go. But there seem to be inherent faults in the MECTA that instrumentation for . will be useful in the clinic. Similarly, the efficacy and applicability of MMECT is so far from demonstrated, that a text as to how it should be applied clinically may be premature. need remedying before the instrument window' in ECT. I look forward to your next report ‘ on the 'therapeutic Sincerely yours, Max Fink, M.D. VWGW’ w Citations: R. Abrams. What have we McGaugh, J. and MECT: learned 2 in Fink, M., Katy, 8., Williams, T. (Eds.): Psyyhobiology of Convulsive Therapy, Washington, V.H. Winston, 197h. T9-8h. M.Fink. - Convulsive Therapy: Theory,and Practice. 306 pp.. 1979. New York, Raven Press, M. Clinical experience with multiple electroconvulsive treatments. gggprehensive Psychiatry 1;: 115—121, 1972. Abrams, R. and Fink, � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Maletzky, Barry Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-029-5-172 Date A point or period of time associated with an event in the lifecycle of the resource 1979 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7e5d8de6e5dc11968b5ef98cc490e76b.pdf 55430bd86540f8acf0d08dab0bd6c229 PDF Text Text -‘ Mww .r . June 14, 1983 Barry M. Maletzky, M.D. 8332 5.13. 13 Street Portland, Oregon 97202 Dear Barry, Thank you for your letter of May 27 regarding an ECT journal or newsletter. Following Paul Blachly’s death, I considered continuing the Bulletin, but the burden seemed too great and the need small. In the past two years, however, the need has become greater, and I have looked into the question. believe that there is little future for a journal dedicated to ECT alone. i have approached some publishers, and each indicated, correctly I believe, that a journal dedicated to one treatment would have a limited audience. More important, it would not attract the best papers. The better authors and best papers would be sent to the general journals, since there they would get the widest circulation. I also enquired about an ECT section in a major journal, and four editors turned me down; again, I can agree with their logic. They accept articles about ECT, and if we made a dedicated section, we might get to use fillers with a negative impact on I quality. ‘ newsletter is another matter. I have approached three publishers and I have prepared a prospectus for two of them. i propose a newsletter along the lines of the Biological Therapies Newsletter, dedicated to the technical and scientific issues of convulsive therapy. If I am successful in getting the funding, the first issue will be out before the end of the year. A My regards. Sincerely yours, Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Maletzky, Barry M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-030-4-103 Date A point or period of time associated with an event in the lifecycle of the resource 1983 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3d577880db7329c817ca2c162866c056.pdf ee7f48ee2bc6a21f240631edc063d66a PDF Text Text February 23 , 1967 Dr. Sidney Malitz New York New York, State Psychiatric Institute Street 722 West 168th New York Dear Sid, I have recently returned to New York and like to re-establish my association with some of the scientific societies in the City. I would like to reapply for reinstatement as a member of the New York Society for Clinical Psychiatry. When I met Arthur Zitrin yesterday, he suggested that I write to you. I As you know, would Would you be necessary. My kindly send me such application forms as may best regards. Sincerely yours , Fink, M.D. Professor of Psychiatry Max MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malitz, Sidney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-021-3-142 Date A point or period of time associated with an event in the lifecycle of the resource 1967 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/745ecbc9f54e4fcd9dc2331ee1876b42.pdf d21a9362f554857185c96956da514dc6 PDF Text Text February 6, 1969 11‘. New Sidney Malitz York State Psychiatric 722 West 168th Street New York, New York 10032 Institute Sid, for your invitetim. to participate Caimittee of the APA. You knm I would ’be Thank you very much in the Mutants I mast, tell you”, however, that I have no committees mimosa , having usually served on the program pleased to do so. of varims societies. My best regards. Sincerely Mex Fink, yam, M.D. Professcr of Peydmietry MF:kp ~05: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malitz, Sidney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-1-041 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3d884d91545ec430a42bb5a5d633f194.pdf ffb7a5e8af4de3e24c92c259d2d363e7 PDF Text Text - ”Fawn-V? WWW 5: :Tntannfiw Febmry s, .... A ,- .nmvsq—n wwrun-a. Dr. Sidney bialitz Rm York State Psychiatric 722 West 18 8th New man-z York, New Street 1959 Institute York 10032 Dear Sid, ‘ Them you vary méh for your imitation to particiyate in the Amangments Omit-tee of the APA. You know I wwld be I met tell yen, however, that I have no pleased to experience , having usually served on the program camittew do so. of various societiea . My best mgards. M 535.11%me Mm: mm M’mp 9"" 15me??? 2' <_ , {KWW-7Ffi'fll‘r 'r‘r'vzm- . ,w I n n1 -. ”L‘WWngVMKW-flflfiflif‘pw Fink, MD. Professor of Psydfiatry wan-r, 'mmx‘my yams , � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malitz, Sidney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-1-047 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/19481d5e25d9f89484ac7857978428df.pdf b5c80af7474c20117a13c32782e5a983 PDF Text Text February 6, 1970 Dr. Bidney Halitz, APA¢Diatriet Branch 250 west 57 New M.D. Street York City Dear 51d. I thank you for your axptasaion a! confidence in the appointment as Chairman of the Cammittaa of Biological Tfinrapisa of the district branch. and would like to accept, but an unclear as to the reponaibilitien of the asaignuent. Is the committee appointed already. and who are the Numbers ? 0:, may I recanmend a committee from the membarchip for your approval ? Are there questions before the committee? Are share ongoing projects that may be raviewad and centinuad, at is the coumtttee beginning anew ? I will call you to éiscuss these questions before replying ta your kind recommendation. My best regards. Sincerely yours, Blnfatnhr ufnroychiacry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malitz, Sidney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-2-062 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/10e987042d868bf3e7e9691236268681.pdf b2acb097c2b82bf6b9af7a04d0433881 PDF Text Text * , annwn—mm.w_ww , I'W ~WIR March 30, 1970 Dr. Sidney Malitz 722 West 168th Street New York, New York 10032 Dear Sid, The request of Dr. Joseph Meiers for a volunteer task force of psychiatrists to support opiate dependent subjects in the community using methadone was reviewed by an ad hoc subcommittee of the Committee on Biological Therapies of the New York Society for Clinical Psychiatry. We are aware of the public need and demand for care, but we direct action be taken by the Society at this time. recommend no To recommend a single treatment model in a condition as complex as opiate dependence is not satisfactory. The apparent need is for recommendations regarding the applicability of an apprOpriate therapy for each case, i. e. , substitution therapy (methadone, heroin), antagonist therapy (cyclazocine, naloxone), withdrawal and rehabilitation, group therapy, etc. To document such a recommendation is complex and may be undertaken by the Society. However, the issue is of national, not local concern alone, and an APA task force may be a more appropriate body to provide the necessary resolution. The subcommittee, aware of the motivation for Dr. Meier's motion, suggests that the Society review pending Federal legislation (particularly HR 13743 and Senate 3562) to lend support to those aspects or bills that may serve the interests of Dr. Meier's motion. Respectfully, Fink, M.D. Professor of Psychiatry Max MF :kp For Drs. A. M. Freedman, M. Nyswander and V. Dole (ad hoc consultant). � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malitz, Sidney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-3-078 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/96ec9b081bd67e85021cbbca802115f2.pdf ddbc7b9739b7251321cac5b67dcabe37 PDF Text Text September 4, 1970 Dr. Sidney Melitz York State 722 West 168th New New Psychiatric Institute Street York, New York 10032 Dear Sid, pleased to nominate Jan Volavka, M.D. for membership in3 the Society of Biological Psychiatry. I have known Dr. Volavka for and years. He trained with Jiri Roubicek, Creutzfeldt in Munich and psychiatrist. Scott in London. He is a fine electroencephalographer I am Roubicek My is a logical seconder. best regards. Sincerely yours, Max Fink, MD. Professor of Psychiatry Mszt 0110. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malitz, Sidney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-8-425 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/56044cbd02e52b799965bbe0e8739bb0.pdf 851a77407c78655e7ffb4f432fb43b16 PDF Text Text E E p. April 2, 1971 Dr. Sidney Malitz York State Psychiatric New 722 West 168th New Street Institute York, New York Dear Sid, In reading the American Journal of'PByahiatry this month, understand why you called some months ago. If, indded, the APA has requested a report on the pharmacotherapy of opiate dependence, it would be useful to have the data Ind experiences with antagonists as part of the record and consideration. The possibilities of significant help to addicts by antagonists are sufficiently viable to be seriously considered. I now Good luck! Sincerely yours, Pink, M.D. Professor of Psychiatry Me: MP:kt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malitz, Sidney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-4-288 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0db399e952602094edc776f0938732cd.pdf 177d78e202c59ae72baf30efebd394db PDF Text Text rimmwwww. www.mwmmmwmw _. _ ! E April 2, 1971 Dr. Sidney Malitz York State Psychiatric New 722 West 168th New Street Institute York, New York Dear Sid, In reading the American Journal of'Psyohiatry this month, understand why you called some months ago. If, indeed, the APA has requested a report on the pharmacotherapy of opiate dependence, it would be useful to have the data ind experiences with antagonists as part of the record and consideration. The possibilities of significant help to addicts by antagonists are sufficiently viable to be seriously considered. I now Good luck! Sincerely yours, flax Fink, M.D. Professor of Psychiatry MF:kt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malitz, Sidney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-4-290 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a7dcf03dea1f76e1c4838b544de2c337.pdf 8e6f09c390b42a87e79ec772fd04b8d5 PDF Text Text October 14, 1971 Dr. Sidney Malitz Chairman, Research Commission NYS New Psychiatric Institute APA York City Dear Sid, It was a pleasure to discuss our common interests, both en route to Europe and in Amsterdam. Also, I want to thank you both for your help in the silver shop in the Rokin—— my daughter was delighted with the silver stage, and I am not sure she will release the Turk on the flying carpet to my friend, Turan. With regard to your kind invitation to join the task APA the force of on drug abuse, I am pleased that the APA is desirous of broadening the base of its experience. Unfortunately, my schedule during the cominh year is overburdened by trips both in the U.S. and abroad, and I will be unable to serve. A1 and I have discussed the opportunity, however, and would suggest that you invite Dr. Richard Resnick, Assistant Professor in our Department, to serve. Dr. Resnick has been responsible for the clinical programs in cyclasocine since 1968, and has the most experience among our staff members. He is well qualified to present our experience. at recommendation is acceptable, he can be reached address, or by phone at 212 MO 2-1899. If this my Again, my thanks and my regards. Sincerely yours, Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malitz, Sidney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-7-433 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/14addfe2593fe6653d3afd7456f3f0ce.pdf ede6054cad1cd9947f5f245c27b34b21 PDF Text Text November 27, 1988 Sidney Malitz, M.D. New York State Psychiatric Institute 722 West 168th Street New York, New York 10032 Dear Sid, It was kind of you to nominate me for membership in the Royal College of Psychiatrists. Alan Miller was pleased to endorce the nomination and the papers went off promptly on Wednesday. My best regards. Sincerely you rs, Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Malitz, Sidney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-031-5-108 Date A point or period of time associated with an event in the lifecycle of the resource 1988 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/fb2562de2f5764acda907e033c44edb1.pdf 45b502800981f6a390ad84637e67c754 PDF Text Text "’f‘mm’w" 'un-W‘ :r’alww .mu-zw—a—wwq-p-mvm w-“ July 3, 1970 President Mallinckrodt Chemical works St. Louis, hissouri Dear Sir, Since 1968, we have carried out clinical studies of naloxone in the treatment of’opiate dependence. Supplies have been provided by Endb Laboratories, but they have been unable to make sufficient nalosone available for oral studies. In December we requested additional supplies and these have not been forthcoming; they have indicated that the supplies are male in your laboratories. In discussing this with the officials of the New York State Narcotic Addiction Cbntrol commission, they offered to make funds available for our independent purchase of'naloxone; and such a contract has been received by this Department. would like to purchase 3 kilograms of'nalcxone; preferably in 300 or 500 mgm tablets or capsules. Is it possible for your laboratories to make such a quantity available? At what cost we made up and with what delivery schedule ? are unable to supply this quantity, can you direct If youlaboratories either here or abroad that can ? other to us an... We am..- '1 -- either U.S. customs, have or can obtain the necessary etc. clearances. FDA, BNDD, my". Thank you. Sincerely yours, Max Fink, M. D. Professor of Psychiatry mf/ cc: Endb Laboratories � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mallinckrodt Chemical Works Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-7-382 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c36a5dbb90be3bd653b57daf052150de.pdf fbff834905e317e309a0436f57c6042c PDF Text Text my 29. 1973 EEGJenr-nel Eleevier‘ halterden Gentienenej ‘ 1 have moved my laboratory to reqeeetthee the subscription represented be cexit1n‘ued, but addressed to: ' a new locat1on, by the attached I lebel and . _ _ ‘Dr. Max Fink HSGuDepertment of Psychiatry sun! at Stony Brook .Stony Brook. New Yetk 11790 U. 8.A. 'lhenk you. ’ ' ‘- ' .. - b . > , . .gtmereiyfhun, nu mg; VPeoteEsqr m of Psychiatry , . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mandel, Sharibeth Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-3-235 Date A point or period of time associated with an event in the lifecycle of the resource 1973 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9363710644a2a0a5181e455d4a5aa2c9.pdf f4b11bd69d3c1a91b9ba487e4ac595e4 PDF Text Text September 24, 1968 Dr. Arnold J. Handell Department of Psychiatry and Human Behavior College of Medicine at Irvine Irvine, California Dear Dr. Randell: Thank you for your kind invitation to present a report of our current electrophysiologic work in relation to psychopathologicsl states. I very much agree with your mission of honoring Bob Heath for his stimulating work in schizophrenia, and I would like to participate. nest relevant problem is the repeated observation of differences in EEG response to barbiturates (sedation threshold and pentothsl threshold) among different populations. The 1961 suggestion that unresponsive schizophrenic patients show their The lack of response to most psychoactive agents by a lack of response to injected pentothsl has been under investigation in Missouri and New York since 1963. The methods of analysis of the EEG have turned out to be more complex then we first anticipated, so that the real data available today is still meager. Nevertheless, if the Program Committee wishes, we would be pleased to review the problem of responsivity to barbiturates as an index of dysfunction (altered function) of the central nervous system in severe psychosis. we can present the recent mathematical models for responsivity and summarize our recent experiences in a therapy resistant study in St. Louis. A Mbdel provisional title: Present Status of the Cerebral Reactivity in Schizophrenia. The report will be written by Dr. Turen Itil and myself. Again, my thanks for your kind invitation. Sincerely yours. Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mandell, Arnold J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-5-471 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/971ac117e7d2af26b1fbbf8db68e2549.pdf 17b289a46b5ae306bebc5e2b0f726fd8 PDF Text Text A w. u w. .4 .“ -v—m «Va-1.....- vvarm-m'rm—w. wwrwv-wu awn—”rpm December 4, 1968 wrzw'mrtrwv nyx-Wiw'uflr'fina v: Dr. Arnold Kendall Deoartuont of Psychiatry Univ. of California at Irvin: Irvine, California J’f-‘l'llbr r H .w car— Dent Arnold, in"? . “.mu'rfz . . rm”: . V A; we diocuosod, I am enclosing thrco abntracts for the consideration of the Fsogran Committee of tho Boeioty of Biological Psychiatry. and and will The abstract on cetubral reactivity in the one toquostod, be a review of tho pant for your: work in our laboratories others. The unilatera1~bilatora1 EC! is submitted to bring to the attention of the Socioty son. of the new tindinga in this reappraisal of the convulliva thetopy protein. The maternal schizophrenia—sex of offspring report is tho most important, potentially of the three; and probably fita boat into the theme of experimental roooaroh in schizophrenia. I am so impressed with the data that I on oncouraging thoso young residents to write a definitive report and uubnit it for the prize contest of the Society. for a Thank you for your considerution, and moot successful program. my best wishes Sincerely yours, Fink, M.D. Professor of Psychiatry M33 mil � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mandell, Arnold J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-6-581 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6218e58ab727e81f9a5fc98c4ec885a4.pdf 8258514d68ad5bcd238b968f6962de4f PDF Text Text Mann 7, 1959 Dr. Arnold J. Mamiell Departmnt of Psychiatry Hunm Behavior Sdmcol of Hedicine of California, Wimity California Irvine, and ' Irvine Dear Arnold , for your letter of Febzuary 21, indicating two abstracts for the Society of Biological of acceptmoe am delighted that two of my young associates Psychiatry. I able be will to present their musual work on "Effects of Thank you Maternal Schizophrenia on Sex of Offspring." I am writing, however, to ask if it is possible to withdzm the papa "Cerebral Reactivity Model in Schiflamrenia A Roappraisal". Some of the work whid'x I, had wished to include has met unexpected difficulties in the analysis and neither Dr. Itil nor I think that we wand have sufficient mterial available by the end of May to justify the presentation. I regret my inconvenience that this my cause you. Thank you for your indulgence. -— Sincerely yours , 1% PW, MOD. Professor of Psychiatry Ifzkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mandell, Arnold J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-2-210 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0de6bc33ff6501fd4dd206123aff42f0.pdf 8e0daee1fcbff0a7875e9da57fbd493f PDF Text Text v. . mmsm.--mW—wwww...s-.ww.~...-.,.w Septenber 3, 1970 Dr. Arnold J. Mandell University of California, P. O. Box 109 San Diego LaJolla, California 92037 owu—PWWrsw .“ww... Dear Arnold, I look forward to seeing you in sunny California in February. There are two topics under study here that would interest the Society. l) Antggonists in Opiate Dependence: The conditioning model of opiate depen ence suggests that ”do-conditioning“ could occur if self- stimulations (needle + drug) went unrewarded repeatedly. Successful treatment of opiate dependent subjects with narcotic antagonists (cyclazocine and naloxone) provides support for this theory, and the basis for a useful therapy in this and other addictions (as amphetamine and alcohol) (presented with A. M. Freedman). Convulsive Therapy: 2) Recent modifications of convulsive therapy (unilateral convulsions, multiple monitored seizures, inhalant induced seizures) have focussed interest on the relation of memory change, altered brain function (EEG) and behavioral change (improvement). Unilateral induced seizures produce significantly less change in various asymmetric EEG changes and equivalent behavioral changes to bilateral induced seizures. This dissociation of therapeutic and ”side" effects allows multiple seizures to be given in one sitting - memory tests, with therapeutic benefits. These observations are of interest to the theory of convulsive therapy and to the relation of brain function and tests of memory (both immediate short term and delayed). I My trust that either topic will interest the members. best regards. Sincerely yours, Max Fink, M.D. Professor of Psychiatry MF:kt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mandell, Arnold J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-8-439 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/110a057a5920a7624091cad8d71ccd41.pdf 60bbaf891ae7256e0a1f63d00d38d2b1 PDF Text Text Decaubor 6, 1971 Arnold J. Mandall, M.D. Profoaoor and Chairman Dopartnant of Psychiatry Univaraity of California P.O. Box 109 La Jolla, California 92037 Daar Arnold: It waa kind of you to writa about 8-2809, a bill sponaorad by Senator Tunnay. I had read thia bill before and found its intant coat worthwhile. Tho meant, however, carry two potential (and unnecessary) pitfalla - a focus on a limited number of ragioual contort, and tha incroaaad focua on a political aourcc of control, notably the white House. copy of my roaponaa to Senator Tunney is enclosed for inforlation. At this time, support for the aatabliahnant of a national A your institute for drug abuse raaaarch and training seams to be sorely noadod. Sanator Tunnay'a bill ocean to diffuae tho energies foam this important effort. Hy boat ragards . Sincoraly yours. Max Fink. H.D. Professor of Psychiatry Ming Ibo. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mandell, Arnold J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-9-577 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/2fe075c950cd1d55e39435ec456f0536.pdf 751be4a627af68a438b7454a90f192aa PDF Text Text December 27, 1993 TO: F aroukh Maneksha George Petrides From: Max Fink Subject: Follow—up on trimethaphan study Now that the dose range of trimethaphan has been defined, we should use a similar design to study the relative efficacy [and safety] of a beta-blocker compared to trimethaphan. Attached is the output of abstracts from a search of the ECT Database for the substances labetalol, esmolol, and nitroglycerine, post-1987. Would you review these and select one as a contrast for trimethaphan? Can you define a-commonly used dose? Is there a design that you favor? � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Maneksha, Faoukh Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-033-3-049 Date A point or period of time associated with an event in the lifecycle of the resource 1992 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/661e75e4a42a0a01705796ee154aa586.pdf 1700ea176b4caf8911f70d05a27225f4 PDF Text Text July 20, 1979 John Mann, M.D. Department of Psychiatry New York University College of Medicine New York City 10016 Dear Dr. Mann, I returning the EEG samples sent me. As we discussed, these samples seem to represent the four montages of a single session in each of four subjects. It is not possible to determine 'drug effects' from such a sample, and when you reach the investigators again, you may indicate that the need is for serial records, taken with bee same montage, preferably at the same time of day and with some control for the state of vigilance of the subject. (It does us little good to get records with subjects asleep on one occasion, awake the next; one hour after dosing on one occasion, and six hours on anther; etc.). I am sorry about the crossing of the two protocols for the study of depression, but look forward to your combining the best of both. Let am me know My what tou decide. regards. Sincerely yours, v ., . v . ..‘.v..:.. w,‘.,_,-,-.~.,..v ”A Fink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Mann, John Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-029-7-268 Date A point or period of time associated with an event in the lifecycle of the resource 1979 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/605bfea9686638d9235d1e8ade39edce.pdf 3f99c5b7f7532a5b58f160ecf8fb0598 PDF Text Text Septefiber 13. 197k Alfred Freedman, D.Cheirmen. Department of Psychiatry New York Medical College 106th Street and Fifth Avenue New M. York, N. Y. 10029 Dear Al: I am Enclosed is pleased to acne a complimentery copy of the EST volume. to you with gratitude IOr your support it interest in this project. I regret the delay in getting it to you, but I was confident that it had been sent as part of the original mailing. and I have received a request for a copy from the APA museum, which I an honoring at this time. If you have any clout with the APA Hewsletter, perhaps they would recognize the publication of this volume under their new books published, especially if an appropriate description could he added. My thanks. Sincerely yours, Fink, M. D. Professor of Psychiatry Mex HF:ed Enclosed � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Manuel, Vera Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-7-528 Date A point or period of time associated with an event in the lifecycle of the resource 1974 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7b9a5eb1c1d7111e0cfe7d595b0b5662.pdf 212e5c3d16394b4355d4416f1feb153b PDF Text Text WrflaV‘m‘m w Wvuv—u—r. 2m “0"“, w. A, m May 5, 1980 Dr. Salvatore Manuzza Senior Psychometrician Child Development Clinic Long Island JewishéHillside Medical Center 271-11 Union Turnpike Glen Oaks, NY lthO Dear Doctor Manuzza: The literature on ECT, including my own large that I wrote an exhaustive review in sent to the Heany Lorand library. so contributions, 1979. A became copy was You may also wish to see the APA Task Force report #lh published in 1978. Between the two volumes, you should get a good grasp of ECT issues for 1980. Sincerely yours, Fink, M.D. Professor of Psychiatry Max MF:sl � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Manuzza, Salvatore Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-030-1-027 Date A point or period of time associated with an event in the lifecycle of the resource 1979 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/26057bf22bd66f63f44ccebd838ab24d.pdf 3c4b78ca05b194495bb970206560fbe0 PDF Text Text ~.':—_r~— .— mvw-mi... F-"vH-v'v F'm'mmwu- WW1 June 11, 1963 Dr. James Margerison Institute of Psychiatry Derunark Hill 'Ihe Maudsley Hospital London, 3. E. 5, England Dear Jim: our EEG laboratory is in spemtion and we are now admissions before the drug induced changes. The screening all our computer mit has also been installed and we have been making up scam programs for the time series analysis suggested by Neil Burch. I am learning how to talk to this instrument and we expect that the AD converting systems will be available in early July. If things grm at their present rate, we should be able to carry out concurrent frequency analyzer and computer analysis of EEG by September. At long last, p ' I have received some excellent moormendations concerning Miss Walton and have offered her a position. Thank you for your momndation. MyoummhereImayhave toldyouthat Dr. SamGershonwas joining the Institute staff. Dr. Gershon, who has come to us from Australia, has been interested in Lithimn therapy and its effects on electrolytes. I brought your studies to his attention, but he already knew of them. One of the studies which he wishes to undertake is a reassessmnt of Lithium therapy in manics with concurrent studies of caleimn levels in phases of depression. Another program which is of special interest to me is the study of Ditran and its blocking agents. For this latter study, we are interested in analyses in spinal fluid of acetylcholine and clalineestemses. While we have some good ideas and can carry out the clinical and pharmacological studies, we are at present, stymied by a ladc of a biodmmist who can carry out such investigations. It is at times like this that :1 regret your decision. In the event, weaver, that any of your biochemical friends are interested in spending some time in the States, participating in such a program, I should be grateful for your recommendation. . , of Diswssions have already begun CINP. in the States regarding the meetings hape that our laboratory will be represented meeting and look forward to visiting» with you again. My best regards at that to Sheila. If .at all possible I Sinoemly yours, Max MF:aw rim, n. Director D. , 1961+ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Margerison, James Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-297 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/50a90a103c3ae87479275862fd7df928.pdf 627a09f9ae528d820a84b9b619d6b4db PDF Text Text August 26 , 1963 Dr. James Margerison Institute of Psychiatry The Maudsley Hospital Dermark Hill London, S.E. 5, England Dear Jim: last met productive and, at long last, I feel It has been a year since I visited England and I still recall that trip with great pleasure. Miss Walton has started to work with us and, as you and the other referees indicated, who is a conscientious worker. There may be some difficulty in training her in the use of some of the newer equipment which we now have, but Dr. Itil likes her and I think she will mrk out very well. The that I am few months have been getting back to the laboratory! » V Dr. Ulett received a letter from Dr. Driver reconnending the consideration of Dr. Serafetinides for a position here. George asked me to" handle this and I have written to him, separately, suggesting that he discuss with you your visit to our laboratOries. In. the event that he is interested in joining our staff, I have asked that he send me a. copy of his curricular: vitae. ; In; addition, I should be grateful for your mommdation cmoerning' the“ pessibility of his making a contribution to the development of our units. Our computing unit is now fmctioning- and my own facility is increased to a point where I have written some simple programs. The first project was to write a period analysis program, following the model of Neil Burch. This-has been done anditworks verywell. WearenwabletotakeanBBGandoarryoutallthe steps of analysis up to the final drafting of the graphs. We are now trying to deveIOp some simple style procedures that will handle the large number of calcula— tions and provide us with some simple measures of the changes of the EEG. The major advantage of this form of analysis is the apparent dependence of frequency and mnplitude, as well as the ability to reflect changes in frequencies higher ‘ " than 30 cycles per second. Of course. with such a sensitive method we are now faced with the problems of our amplifiers and find that the frequency responses of even the newest and best, is limited to a small band. We are going to apply this method first to the simple problem of defining the changes in pentothal and as soon as I have some definitive information, I should be pleased to send it to you for your My connnents. best regards to Sheila. Sincerely yours, Max F111}; M. De Mfzaw Director , \ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Margerison, James Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-403 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e8e88086f949a2cf7ec84ccda3a96398.pdf 6f85cdd7838e8621ab2a9732ac4aa839 PDF Text Text October 1‘} , 1963 Wm of Dr. Jams H. Imtitum cf Psychiatry Dapartmnt Wall. Emmy The Mmdalay Hospital Hill Wk warm. 3. E. 5, England mar Jim: mingfimsepmt {hm follamdupthemowmdau fwm mum u mtg indeed very titan of Dr. Semfefinidas. I for yam of your hesitancies. as subsequent inquiries atmatantiamd flanks. m Ihave just mtumodfimme AmricanEEGmtm. 63th mny Agood portion of the time was to reports about automtia EEG analysis and the application: of averaging techniques. I fame! that the mmndod waEGamlysism innovay superiorto Mum cam. Dmingthepast wmmuflaomwin probably .fimmflm.mhawdovelopodbothfluoquimntmdmmcmim BBQ with 1710 m to use the me computer for the analysis of mm models: Period Myth (W), Power Spam, and than W inasmllatflymmeffcctoffintofinlinmcmzomfim. auto-am! accumulation. to gut mmifioent wall. ms While um equipmt which mflwt subtle It is w hop. that we will Wmte is small. I am able with drug wry the value of those named: nowinprows. Sam amofmumhpmjem omtinmdwithfimpmbhaefbloeldngmnts to Ditmn, Thoreau What Maddalsm,tnhadaatudent amt mmmmmm. a mplimim of Dr. deam's report on dift‘mnoaa in louoocytes in patients. Of me, he was unable to cmfirm this sflWa an. war-v �Dr. Jam 3. Margarine!) Octobar 1%. 1963 Page Two 50 Wemhizophmicsmflasmllw www.mhaw mania mmtber of patients. In the ehmic schizophrenics. m are in. tomted in determining the extent to which chronic brain dysfmctim mists and may be a factor of their poor response. These thc extent to failums are a Wilma ifWtic mm whidmnrmiabminsyndrmsmafactor. Ibeliavewemaybeable the efforts of am mute mm centers in a m satinto factory and we can (lemming focus fashion. mm is repeating his Lithium of Victim blood study. hum, m. (This oatims War a ”strict" dietary omtml. is, of came. the In the manic patients. Sam amber: introducing We most a difficult part of the study). mmbeensurveyingfiaehospitalpopuladmtobdngm of. opiloptim and is 1:1th in thc relammthdvpasts—Waited EEG cramps ta their waviw. t‘ien of all of this. we we assassins the valuc of mm13mm zineinmmpofpatimta. Inmtrnr.mlnvetalmnthcmoffall ugdioatim and anticipate very on, little dung. if we hep them of! medica- Ithasbeenafullmsinmxcmtomsswimdmllook Imamtlmwillalwaynboaplmmrymifywmmmwayclear tosponding smatimintmsutes. mmfwywhelp. wmmmgmmsmm. aboutmlmdelighmdthatmhaveanopemtingm‘gmiutim. Anya: Y 3mm yams , Max Fink. Dimtw MFzmlg H. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Margerison, James Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-7-483 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/357ed26b363977d87114e745ebbe4a20.pdf a1c9aac6b6cad157d7ccca62cfe96d80 PDF Text Text October 28, 1963 Dr. Jams Margerism Institute of Psychiatry The Maudsley Hospital Denmark Hill londcn, 8.3. 5, England Dear Jim: As the "mfficial British consultant to this Institute" (a dubious honor with which I hereby invest you). I muld appreciate your accepting the following chore. I have received a letter from Dr. H. Lentin, a copy of which is enclosed. I have taken the liberty of asking him to call you and would he most geteful for your meats regarding his personality, his mason-13 for coming to the States, and an estimate as to whet cmtrimtions he could make to the clinical in the Institute. research prom ' If he does not appear suitable formy shop, we do have Opening State Hospital for clinical the at ‘If you think he might be suitable for that role, I would appreciate your cements. pawl. Sincerely yours, Max Mfuw. enc. 2 Pink, Director M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Margerison, James Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-7-529 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8a8c9562312bb3b6ee2747eb36288bd7.pdf 550002d6a1c45e4731bdc02d19c3b08e PDF Text Text ‘3 13w ’3‘“ ’5. ,, "‘Mkk-MfM v: 'J‘.‘ (3,; n ‘ Km Dr. Jams 16 , 1983 We: of H. Wu Imtituta 0f Paymiatry Dam: Nauru].0W The Why Hmpital\ Wfliu W5. E. 5, England Dear Jim: I am very mtoful far your letter regarding Dr. In the swam past. I received a latter from him, and ha very enthusiastic about aiming to the unipd Status. I man. am most mtfiulfwymrinlpinfldam. albawhadanmw Inhmldbom’c mum ierculd callm'you mum”, again. Inthismmylmtmfimkwawphcingtmm Mamidamluwmsmdand Whmmam. NW may. 8mm tom mum Imtakingthalibwtyafmndingymdwpyofmm~ mas Carole chntiala. of cm- appears tar. Ihavawittmmm.arxiifs}misintmmd,1hawmgo Wthatskncallyoufmmymminfmfim. Ifshedow m11yw.!m1dapmcimyummm. Inmafimletm.1mmlmmtamdflutymm amappaintamt. Immtwmtidwifltyweffmtamlop amdaparmnt,fwthispmtmhmbomawminiamfiw films. Hemitmtfwfluemimtofwmm,lmmhm Witimdbhwmim. m.aftcrflnfimtyw,it Wmtmmndnmimingmnmofdmmmmh fitm.m1mhymmmem1nmaffm. ‘ �Dr. Janna H. Morison November 16. 1963 Page Two for'indncdthmis Ian plmdfimtymlavesnnwhom. The be Superintendent memgssibility that I may caning to mallard. and has Dr. Ulett replaced him with a hospital has resign! with research experience. In an effort very fine yomg psychiatrist the menial, advertisefor to mnruit more qualified psychiatrism British Journals. If the umber of replies manta have been planod in would probably be advisable for me to visit England are sufficient, it few days to carry out the intervlcmng in person. In the meanfor a time,IIshould like to be able to call on ya: as the need arises. mutant regarding the analyzer output being nonlinear is quite newest. We have recently challenged two analyzers and detsmimd tbst there is a sharp fall—off when voltages are less than one-half the the assmnptim in Hnuslsr' s monk, and others, calibrating voltage. I third:from subject to subject are identical. If is that the basnhm records indeed classified according to the pmtmammnt record slursubjects were with actnristics , than paramtmc statistics may be applicable. However, 1' think the more com disregard of the pretreatment characteristics, yam meat is quite newest. Wing the last few months, we have been using a digital oanputsr to determine the spectrum in the mmbnr of our records. I have satisfied myself flat the amplifier and the conversion mthode are linear up to 80 cps. I have an additional program from Neil Burch for baseline cross-analysis, and will, in the next few months , carry mt a oomparism between the two techniques in order to dotemdne the conditions in which they are simla’r and dissimlar. Your pm I have just received ycmr article with Barbara Tizard, and should have an opportunity to read it in detail before consenting. Sincerely yours , - Mleg Ens. M. Director MEX Ms D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Margerison, James Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-8-574 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4036ba2474b35ab9981a5127c5db1bd8.pdf 995c585ebad37389268e80aa75f739fc PDF Text Text (w) git-7f ; December 27, 1963 lb. James Margerieon Institute of Psychiatry The Maudsley Hospital Demnark Hill London, 5. E. 5, England Dear Jim: New Year. Again, I am writing to ask did Dr. Lantin. The other letters which with us you to help as you he receiwad regarding Dr. Lantin were such as to lead George and My best wishes for the myself to offer him a position at the hospital, with the idea that other after a year, things warmting such a transfer, transferring him to the Institute. I have recently received an application from Ir. Alexander Don, formerly of South Africa, who is now at Werley Hospital in antwood. I am taking the liberty of writing him and asking that he call on you. His cmiculmn vita is enclosed. Would you be so kind as to let us have your Opinion again? I have also received another letter from Miss Carole Warner and have urged her to call you and have you to, perhaps, also provide me with an estimate of her personality. My best regards to Sheila. Sincerely yours , Max Knew enc. Pink, Director M. D. f“ 53»--y‘w._..w§ga.«»~,-,x � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Margerison, James Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-9-663 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f8a42793ca80e3544a14e88e13ea483f.pdf 3c2f4fd558f384fa49ae2c6cf847e197 PDF Text Text January 29, 196i; Maison Dr. Jams Institute of Psychiatry The Mandalay Hospital Denmark Hill Lemon, S. B. 5. England Dear Jim: About a nonth ago I wrote regarding an application we moaivad from Dr. Alawxder Don. His credentials were excellent fmm meessor Hurst of and I have recently received a SmthAfricawmgavehimavcxyflmmmndafim. 1am amdcus tapmcossthis furtrm,buthavcmtheardeimrfm' lam . him car from you. Hm he contacted you? himmmybemlf? If not. wwld you‘ocmaimr caning Mammabkimgular.butlamfamdwdm‘ of the a choioa at the present tin» of wounding appointmnt a psychiatrist such as Dr. Don, or using the same fmds for a warmcolomt who is intemted in caning in September. It would be helpful for m to law meme)? ha is intemtad, and whether I should process this further. Wflunksammbostmgm. Sincerely yours , Max Pink, 133.th Mleg Alexanchr M. Don, Harley Hospital antwood. Base England , M. 8. M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Margerison, James Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-1-093 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/dee9ff0c7948edd6ce588e7c6d312684.pdf cffe79152ca460f0c7a2ae52c9f6e22d PDF Text Text February 14, 1964 Dr. James Margerison Institute of Psychiatry The Mandalay Hospital Denmark Hill London. 5 age 5’ England Dear Jim: was pleased to receive your letters concerning Drs. Don and Lantin. had already received a very excellent letter from Dr. Hurst concern— ing Dr. Don, and have just offered him a position at the Institute. I I may than“ a Dr. Lantin's hesitsncy in joining the hospital staff appears to be considerable, and I have followed your note with a letter of my own, indicating the extent to which this community does have a large Jewish pupulation, and the integration of the Jews in the community. on you once again in that I have just received' George Shaw, whom you may already know since he the Mandalay from 1956 to 1959. A copy of his c.v. I would like to call application from Dr. registrar at is enclosed. and I have taken the liberty of writing to him, suggesting that he call you. I have, within the last week, received an invitation from the CINP program committee, to participate actively in the 1964 Birmingham meetings. I accepted gladly, and now look forward to being in Europe during most of August and part of September. For this reason, George was and I feel that it would be unwise for me to travel now. I have urged him to join me on this trip and I think may be possible that both he be and Turan in Birmingham during the well as myself, will as week in September. first it Itil, I would be most pleased to have an opportunity to visit with you either our plans are before or after that meeting. Martha hopes to join me for part of that time and, with some good fortune in our finances during the next few months, I hape to be able to visit Israel as part of our holiday. My As now being developed, best regards. Sincerely yours, MF/jb Enc. ' Hex Fink, Director M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Margerison, James Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-1-124 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence