19 100 6561 http://exhibits.library.stonybrook.edu/mfp/files/original/019b11a16829ea6aef8c7f5187b92c3d.pdf 56552249cf0daa24c502cec4e4fa74ec PDF Text Text November 2 , 1965 Dr. Alfred M. Freedman York Medical College 5th Avenue at 108th Street New York, New York 10029 New Dear A1: I have ducked the airline schedules from San Jam to that Eastern 958 will not run from San Juan member 15. Instead, Eastern 952 will leave Juan at 3:05pm and arrive in mm at #:2613111. I hold Miami and find to Miami after San reservations can this flight. travel agent here indicates that your agent will probably transfer yam." meervatim from Eastern 958 to Eastern 952. The thank you for the invitation. Sincerely yours , Hex Fink, FLD. meesao!‘ of Psychiatry Mfzkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-7-579 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f41b70dd880f3b16ef05a5b82f0c18d8.pdf b007c9183bca48a96946f17311d2dfbc PDF Text Text Decanter 3, 1985 Dr. Alfred M. Pmadmm York Mon). College New Fifth Amos and Now York, New 1051:}: York Strut mm: is the form, completed to the Meat that will note that some of an listings are mmoopiosfrommurllerdomnt. Iwouldoxpectﬂmt ywwilleditthis mditwlllthmbemtypodeltlurinyow ofﬁoo or mine. Tm mom 3mm: application will be completed Holzday we Enclosed diamond. You like office m to am“: in aftcmoon and should be in by Wednesday. Now York at 6:05pm at I m whoa-113d Kandy on mmday and will to your home directly. Bunions diswsing the project, I believe we should take the ﬁrm to My best go om those m two mpuoatima in detail. mam. Sincerely yours , MI)! M, ”an. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-8-644 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d93a8710c249c7cb430427d9637d4bc7.pdf 50c508d92226e86dfcb9359be29b452a PDF Text Text December 28. 1985 Dr. Alfred H. New mm York Hedioel College Fifth Amm at 106th Street new York, New York 10029 DeerAl, Winter has actually hit Hissouri and we have had oold and so rainy days. I guess I regret not having stayed in Florida enjoyed have hope you I this point. show at a mten that I can your stay. v . of Lancet helmet! is a special article from the latest issue We already describing one eppmeda to a medioal records system. franthe'mlme theBMpmmm, endalsosoma apeoialones merely the and is it not 'mese mine: are Comuting Center. have applicatim of emery and may to make such Center. a system work in our with some of the I felt it was necessary to discuss my leaving that my miners of my muting facility md they are nowbewere about optimistic would While not I support will end this amr. a position jmt been offeredconsider taking him from St. Lwis when he hasshould an seriously WU that believe you Famlty, I on the hesitation Without Donald Mr. Shapiro. invitatim to my associate, oo-workerlhevehadin Iwouldsaytmthehasbmthebest discuseed with me is to which you thirteen years. If the program could eooolmlish the he believe I be lemoheo with your support, himself energy to collaborate sufficimt allow mission with ease and of evoked potentials technical aspects more with Roy and myself on the his 13.32. from He be receiving "will or Wiologioel malyeee. WU this spring and is one rated to he paid $17,500 to start. his interests, I would be very optimistic If we could atimlate about developing a mumphyeiologioel analytic unit and obtaining NIP swport. His ourrimlm vitae is enclosed. My best wishes for the New Year. _ Sincerely yours . Hex Fink, NJ). Professor of Psydtietry Hkap P.S. Bynowyouheve probablyheardtmtmmoomiesionerheeheen invited to take Paul Roars place. If he does, theHebrews from the of the flight of the Hineouri will be land of Egypt. Mount Whom � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-8-704 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5d4205e9f5796b2394f0f57c55e36543.pdf d6da5cb4fe78d8e5faf7f4a02bcf6268 PDF Text Text ~. ;. ,1:~7W.;~,..Wm Arr ”.ch w Wrr1~ww$7 .97. «. “awn-q Bummer Dr. Alfred New York New York, H. 30 , 1965 mm radical College Fifth Amue at 106th Street New York 10029 MAI, I would like to mean myself of the availability of the facilities oftheNewYarkmmyoflhdicineLibrmymdhm writtun to them mmating informatim regarding Fellowship. The librarim, Miss Annm, indicated mat I will mquim ondommntbymmfellm meofwlmmt 01mm, behalf. procure the namirmtion blank an H133 W I would be my grateful if your secretary would write to or to Dr. Bernard Pamlla (Semtuy, Arman mm Conﬁrm on missions) of the m York of Medicine (2 East 103m Street, New York 10029) wasting a rumination blank. I would be contact grateful if you would nominate me, and I will friends for the necessary additional support. 30m unmar- Sincerely yam. Pink, ".13. Professor of Psychiatry Max Wzkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-8-713 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d396e5b2abac11880f9d1cfe7df69654.pdf e51dfa38526ac1d97f4d629753256ad0 PDF Text Text January 18, 1966 Dr. Alfred M. Freechm New York Medical College Fifth Avenue at 106th Street York 10029 New York, M Dear A1, would be e pleasure to have you visit St. Innis during in your letter forthcoming trip to Fort Worth. You indicate your 13th luth of about the be thrmxgh or coming would that you February 13, Sunday, on would be see you to pleased Febwery. I numbers of the meet have you to would be more practicable but 1». February staff on It it We W1C! be pleased the residents during (I suggested scum to have ymm you emerge for you to speak to subject visit. If you will select a(madman aspect of narcotic addiction to the of the Training Gamittee) we will armge for such a meeting during the early afternoon of February lu. The work here is going quite well and I hope to have a goodly humor of reports completed by the end of April. My next schema trip to New York is for the Psyclropethologicel 18. I can arrange to stay over for acting, on Friday, February arrive one to two days earlier if that may, February 21, or be work dare. to more is some Sincerely yours , Max Fink, NJ). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-1-048 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8b1a896945d5e7b91a60014bab346105.pdf dc27c72a4e2009c5c2b9919f85da04c0 PDF Text Text January 19. Miml Now York New York, New York 10029 Fifth Am 1966 College at 106th Street Dear A1. ._ I have received a letter of appointment for 1965 from Dr. Snyder's office with the request that mmbership in the association of the Americana Hadieal College is Wand. Enclosed is my applicatim which should be forwarded Dr. Snydur's office. Sal-manly yours. mm, M). Professor of Psydliatx‘y ﬂax Hf'mp t0 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-1-060 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/afa22fc85591771f224ae229aec630eb.pdf b93e05f82f1b67bb293059640e01e4f1 PDF Text Text 5mm 28, 1966 Dr. Alfmd New M. Freedman York Median. collage Fifth AW at 108th Street Nu York, Hm York 10029 DoarAl. I Mmmmmrmlamrofappoinmmt. lodtforwudtojoiningyowstaffinlmhprilmm mthmMammmingfulmtxﬁmm mWofmmtmym. to MmafwmmmmmSMImld led itbe liketo discuss betmymviait inFebnm. mmhforymtomnmatymhimmemmy athemnwmday? Iwillbeamymﬂmday. Cmywmfimymmviaitmhbnmylﬂ? Wahava MWmtalkaa"WofDmgMdiaﬁm." mnwmdmgcdifitismtmptabh. Hybastmsards. Sincerely Max ym, Firm. NJ). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-1-077 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6f0512884a01a5f530609cb9e6909d4f.pdf 1432a1fc52b9b915e915f97567dd284d PDF Text Text Polmxary u, 1%6 Pram Dr. Alfred H. College mum106th York Fifth Avenue New New York, at New Street York 10029 DearAl, m Emloeed is the application for an research gaunt, to permit an to complete on tha present EEG tglazalyaes 13mm. Imuldhamte fmmmtmywuldmlete the approyrdata covering form and have the face sheet signed by Dr. adder. If page one is than and the coupler“! application sent directly to Jonathancollated Cole, the procedure will he coupleted. I am waiting to him to indicate that this will arrive about two weekahtc. I atmldalsolikotoemﬂmayvisitwimyouon Pebnmy21. IhaminvitedDmShaplmtomtoyour office about 10:00 am. Attached are m-mpies of his currimlmm. Hanythmks. 31ml); yours. ﬂax Pink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-2-086 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4be2134923d007833def1b904b6ec292.pdf 9696928d9a62fe477e9f95e79af46e52 PDF Text Text Faraway 28, 1966 mm Mien]. College ka Fifth Avenue at 106th 3mm: W. Alfred M. New York, New New York 10029 MAI: Imwridngwithmgardtotm collabmtionyouhnve with Em. Jun. minus available Ihawmvmdtlmeitatmmd laboratory md find that they are prﬁuipnny of three kinds. The majority relate to studies mitiandmtwmmtim ofﬂnmmmdmnmwith normal subjects. Edema in this in paydmotim and in my m regard go back about twelve m yum. are two reports, one of mien is in 1965. describing theEEGWinmilctwodaclmimplmiawithmenphmis an the for on two EEG Mt mm. with Finally, I haw citations reports regarding the effect of ninhmide and Hajeptil and behavior of psydmotie subjects. W bolim indxmd Of these thm subjects, the tropic drugs on EEG and behavior is prdnbly the mast coma intemst, although I by psycho- m of that their wntzibuticn hasbeensmllintrdamgazd. ,Ifﬂzeymintematedin such a abject, than this is mt easily done. W that their I tia in conditioning believe greatest utudiet. Unfwtumtely, I have done 0 the“, and if this booms a primipal focus, I believe that Roy would have to .bo involwd aims he has dam such studies. - thatofEEGcmain Mrthizdamofintemst, another subject in which we is mum. both have been interested and could be established if we available sdﬁmphmnic .--__. rupn,» . n m”. ‘ Ugcrw or,“ -»-; 1.9.,- -v.«-;-1¢-:w4-..< gram-.— '1 pomlatim of adolescent Wopm’enms for study. had a . �Faraway 28, 1966 mm Mien]. College ka Fifth Avenue at 106th 3mm: W. Alfred M. New York, New New York 10029 MAI: Imwridngwithmgardtotm collabmtionyouhnve with Em. Jun. minus available Ihawmvmdtlmeitatmmd laboratory md find that they are prﬁuipnny of three kinds. The majority relate to studies mitiandmtwmmtim ofﬂnmmmdmnmwith normal subjects. Edema in this in paydmotim and in my m regard go back about twelve m yum. are two reports, one of mien is in 1965. describing theEEGWinmilctwodaclmimplmiawithmenphmis an the for on two EEG Mt mm. with Finally, I haw citations reports regarding the effect of ninhmide and Hajeptil and behavior of psydmotie subjects. W bolim indxmd Of these thm subjects, the tropic drugs on EEG and behavior is prdnbly the mast coma intemst, although I by psycho- m of that their wntzibuticn hasbeensmllintrdamgazd. ,Ifﬂzeymintematedin such a abject, than this is mt easily done. W that their I tia in conditioning believe greatest utudiet. Unfwtumtely, I have done 0 the“, and if this booms a primipal focus, I believe that Roy would have to .bo involwd aims he has dam such studies. - thatofEEGcmain Mrthizdamofintemst, another subject in which we is mum. both have been interested and could be established if we available sdﬁmphmnic .--__. rupn,» . n m”. ‘ Ugcrw or,“ -»-; 1.9.,- -v.«-;-1¢-:w4-..< gram-.— '1 pomlatim of adolescent Wopm’enms for study. had a . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-2-130 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/bc3927b448fda06b7fb7d0e0de1ff16f.pdf 9a822066659c9a93035617c6dcc190f9 PDF Text Text Ham 1, 1966 New Dr. Alfred M. York Hndiaal Gallup Fifth at 106th Street New Yam. Haw York 10029 New Am MM. MImﬁomdtoym,Imnp1emadtomeloaeacopyof the auricultm vitae a! E. forapositlminmnamofmmloformmidemtim . Ifimtbeem‘ mudwithmmmmwmmampmmmfmu hmdmtomﬂrm’ngandomdmgtheobaarvatimsmdeby Richard P. mitts, .Bumr'agtmp. wmmmfwyemlmadlittlaofhiswritings I began to review ms arbliner‘gic mdmism in 1962 when until psycmu'opic drugs. Imfmmmmmmmmmwhpmlogy spring, hemminvitod participant. ofanticlwlimmiuagmts. Inﬁnsuamedingyem,mworkm mtimndinﬂdsdimctimmdwtmnmommiwdamosimm mﬁmnlixnrgio drugs at the Socisty for Biological Psychiatry last thmmmtmtymmtmdhxgmdamﬂxmm Immntlysenthimawpyofmymviewof Wad. shamanism in convulsive therapy for which he provided (homage a Wtful and helpful critique . have InourplanstowgmizethefortrmmimmSympmim,ny W. mmdationtom‘. Bmdlaythathobeinvited was imdiately Ibcliowyouwﬂlhaveanoppovtmitytohaarhimat that mating. meossiaully, I to our form have found him muting. I hope that this in Mlpful. likable and I look reward Simmly yams, Ha): Fink, H.D. Professor of Psydxiatzy � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-3-133 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d5ae4ffbbb5d079b315f64d18fb082e1.pdf b5d96fe3c51c264aa1228f3bf0333182 PDF Text Text March 17, 1985 m. Alfmd New York New York, M. Madam M1031 6011934: Fifth Amman at 106th Street New York 10029 Ilsa:- Al, Aslmntiomdmyuu.1hmbmeomctinginmtim mmuwmmdchmybemdformsempmesin Bumps. wtnuiryformyhasmtomgm,sinmfmds Masﬂneenclnsadwpies mmtwailablamthstmm. indicate, meauablcinmlmdmdpemapa this infmtimwouldbetnlpfulforym,attmﬁnnma:tym thmfensorJus. I have minted the sense of mm discussions with Don. misquite inmtedbutasayamgm. the ultimate question isﬂntoffiwmialsuppom. Imxldbegmmfulifwumld mimhismmdwlmvitaeandmllmatymmlstsmto mmgsmmmduwopmte‘mmmmm mmmmm meetiwmfimtofﬁmyear. m m. Simly yams, Fink, H.111. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-3-185 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d47a64bb66b0d69431b1974ab328df25.pdf 352f0950353fc4453a633182d932fad0 PDF Text Text April 11, 1966 _ W W (binge Fifth Am at Strut New 11'. “n York Radical New Yam, New 106th York 10029 MAI. Iumtﬁmtymmmtingswithﬂlﬁllermmwn. metmkmMchmmmmdiﬁMfm inwatigaﬁ‘pne with cyolamcim. 'Iho Watims am still misunt'deamquimplmdwiththestMyaofw. We mmmMHimmomdsm,mtofWiats. Iwiuﬂyinmﬂcwfokammingmdwinm Asymmystillbein tomtxwonmmmﬂaymg. CalifomiA,Iwwldhamfulifyouwou1d1eavemmml WMMMmMthmmwgemm Mdaywmauy. 31m Aslmtiaud,1hwebminvimdmpmicipataintha April 21mm. visitatﬁﬂmmmdaymdrriday, the festivities with Dr. Bleultar. miswillmuimmmmiaa Immtlmybeemed. Ifwaoelmtitismm valmbhfwutobeatﬁnmmcomgeatmtim,I wﬂlmlaintom. . $5le your: . Nam Fink, NJ). meessm of Psychiatry Wzkp P.S. WyouwouldlikotostopbymymmwaytoCaIifomia. Iwillbo availableaumkmtil Friday evening. 1mm! beplemdmsrmywaboutﬁxehbomtoriwhm. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-244 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4ea36104058a009c44093b0904f4d881.pdf 29c33d61d43d4d2926ad71001a9f9307 PDF Text Text A May Dr. Alfred Chaim. M. W 81, 1966 Com-mar Ooamittoe Yeti: Medial (blaze Fifth Avenue at 106th 8W1: New York, New York 10029 New mm... Follawing your Wtime, I have recently prepared an appliceﬁmfmemmrwmntmichiebeingemttedtotm Public Health Service EEG entitled ”Quantitative Studies in PsychoThat applicatim pmvides for the 'm-eetablismmt Way.” inbiewYerkofﬁndigitalmmterbasedumlyeeeoftMelecm~ mam ermpheloy-em mick“: has been explored in for the past four were. At the present time, the equipment in St. [axis is based on an m»: 1828 amtrel and the mtnllatim is deawibed m an IBM-1710 emtml system. pm Inmiadngﬁefmilitiee ettlnﬂew‘lommdicalmnega “mmtmyepplicetim fw‘mequipsmwﬂlmyeminimm ofetmmrdelivewdehy, mapplimtimpmidesforthe 1820 by the specific components mutiny:to of the available it ta e 1710 system. The mimetic»: requests mm wfwemyeerperiodwiﬁzmis eystem, endthmmup» W Mmmmmm. Attedud are copies of the specificatim far the four mafiatime ma mique pieces of equipnent mammary to magma-at the IBM 1620 Mm York . me fma;t. Innis. Radial Gollege. me specifications are those taken Imuldbemtefulifywmldamdampyeftheeespecifiea. timewithtmoollege Welteﬂmelﬁdmpneentativa, Hr. 3116mm, at 220 meme Nw‘fozk City. I balm it Robert muldbe eppmprieteﬁntymindimmtthiaequimmtwinbemqmmd 1. «9.30mean pmidedttatthefmdeemmde mmwepplicetim. * aveilebleinW �Dr. Madman Secmdly, Output-er ~2- May be grateful if you would review with the and the offioors‘ of the Center the to utilize tha basic 1620 for a minirmn an I mid WW possibility of mm 31, 1966 War Wt Aslindieatedinmy periodofappmximtnlyarnmdaily. of April 29, I would be mteful if the facility could availabla to the EEG pmject prom daily fmm p.111. to frm to“ Mt aakthatnomntaleostbeimmedforthis timbytheEEGpmgrm is this prom ha made M and Satmﬁay and Suway 8 mm. pan. I would and that the equipmnt which named under will be Center far other users at other times. available to the WW Ibaliawitis almappmpriamthatmindicateﬂuttmm will movida the mm). for its operatimw prom during than hours it utilims. Thank you for yew assistame . Sincerely yams, Max . M'Ftkp cc: Mr. 1min Samar-tn Fink, Md). Professor of Psymiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-323 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9d427ca5a6932978a1a5ff75546d1802.pdf 4881f677fab91cac0a1f30a8a784f97b PDF Text Text ME '10: Alfred M. m: m Pink, Mn, M.D. M: HOD. W 28, 1986 W vii. InalettwonﬂnggnberZLDmmmmmpliedm ammuafm.82up mummomtimndthmpeutic W. activitieswiﬂmgtappmvedfmlmpmiaimfmnaﬁofﬂds Onmquirytom.81npimmgudingthnoriginof lurreqmnt,lfwxdtmitmofmm. m.uvdm&nithmqwteduuyingmtnr.mon-waw mmwmtmmmmutmmmwbym. Itmalaoatatodtlntbr.Danm—Whaduqueatedmypemis mﬂnmmthatmmmtfmaﬁminguapmmt. Atmtimhnsm.Densen-Gerbormghttomyattentimw mimmivithswithwyamym. Mmmmtony attmtimbymﬂmmofthesuffandlaanodm.nemenm mwoffionammqmatodomﬂmntim. mimimtedthatmmd bemmppordngtrnmatmysuyme,mmnyandﬁnancmly, whaumdmupauibﬂityfwmmmntpmm. Immanod autumn: W,upecia11yﬂmshoixﬂicatodtlntdthwmbu~s ofttnstaff.1ncludjngmnidontphyaicim,m'.8m1m,andmmus Mainsmmintainmgmwtivethumxticintmst. Atmtim didlfmmllywinfomanyomdomﬂﬁsactivity,mtimmtedﬂnt Imuldmmicutcttnobmatimtohummdbr.hplm. Wﬂﬁsintmiaww.ﬁdmdhsnickmpmmt. AtmotlurtimdtmimtlnputtwomnﬂmruveIfmnyor 31m Dr. Barman—Gum permission for traumatic activities outsidc the fame]. mutant prom. Withmgardmhorlettwofﬂovmbwn,1fimmmlusim informally Myiwmpwsimeitiomymaimtmrmmmm mimmidmmumxﬁmdmmtinapmiﬁmtom takothuupeuticnlatiuuhips thoutaupmiaionfmmlicmaodmff. Since Dr. Damn-Gerber indicated <31me to me that Mmlatiomhip toﬂnindividualsatOdyaaayl-hmemﬂmtofatmmm.rdomt believettnttnrmteofﬂmmbcr2lismapomivetom.8mpim'am mus“. AcarbmofthiomteisattadudandIfeelsrmldmlybe communnanm-Garber. MPﬂcp cc: Dr. Harold Kaplnn � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-8-517 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/541d1cbdffd45b69d4f8587854c77513.pdf e800d831487c1daa2a01c008271a9c1e PDF Text Text May Dr. Alfred M. 8, 1968 Freedman Chairman, Department of Psychiatry New York Medical College 5 Best 102nd Street New York, New York 10029 Dear Al, and Dr. William Karliner is a practicing psychiatrist in somatic therapies with offices both specialist and He has an extensive practice New York. in Westchester at Gracie He and has Square Hospital. has heard of the reorganization of Grasslands indicated facility. an interest in participating in that In the event you decide on the appointment of an acting director, it might be useful to invite Dr. Karliner to participate in the planning, development ﬁe and administration of a somatic therapy unit. He him commend would and I do so to eminently qualified to you. Sincerely yours, Max Fink, M.D. Professor of Psychiatry HF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-2-176 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a841a1373e73842d9cfb2d2e5e90a913.pdf 7d943bf30e4a8ec02a7f29703824ddd2 PDF Text Text Juiy 18. 1968 Dr. Alfred M. Freedman Chairman of the Department Department of Psychiatry York Medics! Coiiege New 5 East New 102nd York, New Street York 10029 Dear A1, I am pleased to send you this volume “Antichoiinergic Drugs” recently puhiished by Elsevier. This was heid in 1966 but most of the editing was done symposium in New York. My thanks again far your support. Sincerely yours, Max Fink, M.0. Professor of Psychiatry MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-3-253 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/78ac771ddba220c853ccac1588333148.pdf d3eee11ae65a18e161fb9fe1721f6fbd PDF Text Text Jun: 27, 1968 Dr. Alfred M. Freedman Departnont of Psychiatry Now York Medical College 5 East 102nd Street ‘ new York. Now York 10029 Door Dr. Froednan: writing to rocommcnd the nomination of Dr. Charles F. Stroebel for membership in the APPA. I am I have known of his work sine. 1962 when he came toHe tho had Inctituto of Living from the University of Minnesota. Hillside boon rccommonded by Gordon Heistad for a position at Hospital but I could not arrange this, although I wanted to, since I knew I was leaving. Dr. Stroebol has done many fine studies in neurOphyaiology, specifically in the area of diurnal rhythms. He has fine computer experience and is an excellent statistician. I would be pleased to have him participate in the meetings - A . of tho 4- ‘ APPA. Sinccrely yours, ~1-rr-Iyuorxiu».v.- Fink, ﬁ.D. Professor of Psychiatry Max Hrzkp cc: - . . . . .u-E" 31$. r”: lnxwgmvk Dr. Gluock � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-3-283 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4ec19c6bb05ecbdae1b8e7ebb02b9c93.pdf 66a53c16f70cd4123a4249787e5131ef PDF Text Text September 3. l968 Dr. Alfred M. Freedman, M.D. Department of Psychiatry York Medical College East l02nd Street New York, New York l0024 New ma "hum W! n , um '«I'Wg' ";‘~r‘" ‘<._ 'v"qvvn< 5 Dear Al, Thank you for your kind invitation to participate in the Second Edition of the "Comprehensive Textbook of Psychiatry". The widespread acceptance of the First Edition assures its continued success. It will be a pleasure to participate again, and I will be to provide the section of "computers and psychiatry". pleased As you know, I am a protagonist of a more general application of EEG to psychiatry and perhaps you could consider the inclusion of some of the recent reviews in either the sections of EEG or of psychopharmacology. Sincerely yours, ; rs n Fink, M.D. Professor of Psychiatry Max <165ryﬂ';7llvv W” i .u-rm Wf‘ﬁ'ﬁs‘. V ‘ MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-5-516 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9a18a712ea670d9ca68e75ed96b338ae.pdf 37503c8fcdd075e7e42ededdce52e8d9 PDF Text Text )'~=Wv'1'rl“»’"4 ("WY new,” 7 m. .. T0: Dr. A. h. Freedman FROM: Dr. SUBJECT: Dr. Frederick Beekeland Max DATE: April 23, 1969 Fink and I have had an opportunity to meet and to discuss his proposed program. Dr. Baekeland ﬂy associates I found him knowledgeable. experienced but tense and anxious. principal interests are in sleep research with the manipulations of deprivation of various stages on emphasis and there effect on mood and effect. He expressed of sleep of sleep research except a passing acquaintance outside no interest His with alcoholism. principal activities at in teaching medical students. His Downstate Medical Center is Impression: Considering the large number of sleep researchers I am not impressed that he has sufficient novelty in his approach research. or enthusiasm to warrant appointment in this area of I found him to be restricted in his interests and I wouid wish to inqdire of his superiors at Downstate whether this restriction does not carry over into his teaching. MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-2-112 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/897850f8a1414d66bde387db05f9a8b8.pdf 80e574fbbcea4a3085278593b741fa8b PDF Text Text w w :w-—- (IIIwrﬁwﬁm‘nmwvwvvldnwv—mraa 20, l969 TO: A. M. Freedman, M.D. FROM: Mo SUBJECT: Collaborative Project with Dre. C. Miras and C. Stefanie, University of Athens DATE: May F‘i‘nk' MOD. 'Avgr‘I-WN‘W mﬂ-‘wmwmwhwpfmwfuir-V'IVW-w-Ir V‘r—- w” -———~w -nw~w‘ Attached is my report of the facilities at the University of Athens. These are ideal to answer certain important public health problems. Do Chronic marijuana users exhibit a syndrome of organic mental changes related to this use? Can a withdrawal characteristics What state be Induced? in behavior and in What EEG? are its are the physiologic and neurophysiologic smoking in these subjects? effects of marijuana relationships can be defined, and are these related to differences in response? What dose Assuming radioactive THC may be used in man, what is its distribution and fate in human tissues, compared to available animal Species? in View of the active Public Health and Department of Justice interests in marijuana, it may be appropriate to undertake a pilot study this summer. Funding for a trial would include: �.W rwwhmw-WVWv-u- - W‘Plvr» Dr. Freedman ~2— Personnel May Supplies U. S. Psychiatrist Greek Psychiatrist (SIBOOO/yr.) 5 20, i969 Salary Travel - $I000 2,500 Maintenance $ 800 ~ — Laboratory Support ‘ Chemistry ($2000/mo) $4000 - — - (SiOOO/mo.) 52000 ~ — - EEG Travel: Additional for 2 American Supervisors $2000 Volunteer fees $l000 Telephong! cable S 300 $7000 contract request 5 2500 $3000 S 800 be negotiated with the NINH (Dr. Yoiles); and failing that, the Federal Bureau of Narcotics and Dangerous Drugs, the Ford Foundation or the Foundation's Fund for Research in Psychiatry. Since an NiM‘i contract is more likely, i would suggest we call first, then write to Dr. Yoiios promptly. Such a may This'hontract" is best presented separately from the proposed Kaéler-typo application, although collaboration with Dr. eras should be included in that application. This may present special problems and could best be handled as a separate, concurrent application, possibly even one submitted through the international Association for Psychiatric Research, which may be more flexible in its fund management than the College. Mszp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-3-306 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/91cf79a725b59675669d982b548f97af.pdf 3f98fb781f13f9c9f3cec140bb93f806 PDF Text Text .... -.».-r A «1- 1.“ .. m. V, a . vow". -_-..c_.~m-.w -..t_.,n “mgr-4.11 a...“ - , ”nu-W v. .» ,m‘...w_~.\..r“..rr .. : w—rq—VlwImr-mrwv1>v—HI"a—Iv‘ -..n.—.., V.”my......,.-.,»n.w~,~r\",v,- rv— v-m» '.'~«‘rt July 9. 1969 ”to Alerd Now York Modical Collogo Ho ROOM, H.13- Profoaaor and Chair-an nopartoant of Payohiatry 5 Eaat Now lOan Stroot York. Now York 10029 Door Al. It givoa no groat ploaauro to trananit tho oncloood roport of atudioo cooplotod by our third yoar roaidonta during thoir oloctivo in Biological Paychiatry. 1968-1969. Dru. Richard Abrooa, Rohort Lavina and Michoal Taylor hora boon unusually productivo. Tho ropOrto rotloct divoroo intoroota. Bra. Taylor and lovino have collaboratod in atndioa of oar rotio and ochiaophronio. Ihoir firot roport. "Tho Intoractivo Effooto of Matornal Schiaophronia and Oliaprins Sax" haa boon publiahod in Science (164: 723-726, 1969), and a aocond. "Pnorporal Schiaophrooia - A Phyaiological Intoraction borvoan Hothor and rotua" in in proao in Biological ., M, -o v A v H R‘:l'-A‘1ﬁ-ﬂf4"ﬁ<(.-"‘ .— wj-qw -mrrucwurv Po chiot . You know that thia work rocoivod ouarda both locally Nov York lonrological Socioty) and nationally (A.B. lonnott Clinical scionoo Award of tho Bocioty for Biological Paychiatry). Tho atudioo hora boon follouod by an additional report on "Tho Influonoo of tho 8a: of Hoopitoliaod Schiaophronica on Thorapoutic of Ronroloptica" which haa boon oubnittod to tho Bullish Jaunnal 0‘ Rsychiattg. Ho hora ainco proparod otudy protocola to contirn and oxtond thoao chaorvotiona by oooaya in tho thorapy of achiaophronio.uith penicilloaina and with Dooogo Loyola atoroida. Dr. Abra-a haa collaboratad with anobora of tho ataft in atudioa of nnilataral convulsivo thorayy, confirming tho difforoncoa in nooory function and aioilarity in clinical roaponoo to bilatorol convuloivo thorapy. A opocial loatnra of thia work haa boon tho dotinition of oaynaatric BEG pottorna which aro rolatod to tho difforant hohowioral roopanaoa. 'h’u‘h. �-2- Dr. Freedaan July 16, 1969 earlier studies of the California I scale as a of therapy choice in mental illnesses , Dr. Levine predictor examined the role of socio—psychologic factors in the diagnostic and therapy practices in our psychiatric service (Effect of Social Attitude on the Ireatnsnt of Psychiatric Patients). Based on also replicated a study of the effects of Cogentin on both EEG and behavior of psychiatric patients receiving convulsive therapy, observing that this anticholinergic drug He slow wave activity following EC! and elicited m the pre-treataent behavioral syndrome, suggesting that cholinergic reduced the activity increases during the inter-ictal period of reported is to be completed.) 301‘. (This viable experimental view of the precipitation of anxiety is encoapassed in the lactate studies of Pitts and Molnre (New Eng. J. Med” 2778 1329-1336. 1967). Dr. Taylor replicated their study, verifying that infusions of lactate precipitated sysptone in anxiety neurotic patients and not in nomls; and that these precipitated synptoes can be blocked by intravenous calcium The study was extended to demonstrate EEG changes with lactate and to pioneer the use of this nodal to define the activity of new psychoactive anti-anxiety drugs (the Precipitation of Anxiety Symptom by Lactate Infusions). A - FFH'a- . A g "qr -.-—, "vat-WWW“wammwmrmm-awxm;m-a These are only a few of the studies that have been done. Dr. Taylor with Dre. Spero and Sisson also coupletsd a review of the clinical effects of chlordiasepoaids in our clinic, suggesting that adaptation (tolerance) does develop with this drug. “I“ (CUMe "imp. Rue, ,139‘1‘, “.3 mush“ Abrams also completed "A Manual of Convnlsive Therapy" ha. 1969). Dr. which described the and varieties of techniques for inducing seisnres is being distributed to residency training programs in various psychiatric centers. year has been productive. challenging and stimulating and ny associates join no in expressing our appreciation for this opportunity to participate in the training program. The Sincerely yours . a," ._,,,‘ ‘ _,.~ 4., .lwmwfwaﬂﬂm'rr Fink, um. Professor of Psychiatry Mar M! :kp - � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-4-415 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/be14ff306c58093bf5920e6b62fcc522.pdf b9281d5107e308d2a6d46b259bc31463 PDF Text Text To: Alfred 980%: Max SUBJECT: Description of the The M. Fink, Frocdman, M.D. DATE: Gctober 17, 1969 H.D. York Hodlcal Colloge-Mbtropolltan Hospital Addiction Pregrams. as requested by Mr. C. a. King, 10/14/69. Now addiction treatmmnt and rosuarch programs at Metropolitan Hospital have teen in operation since 1966. Many modcs of therapy have been assassad, and the most successful has been the “pharmacologlc rehabilitation“ approach. substances that In thtse, the subjects art treated with telltva opiate hunger or prevent opiate dependence, and are concurrantly continutd in an intensivc aftercare system to assist the davelopment of thair educational, family and job potentials. The engagement of the subjoct by the gharmacologic. approach has lmprcved the success of the rehabilitation tachnlqua alone. Qua problem has bean and this is to dav310p morn a goal of our programs. we affective antagonists have studied mtthadone, tybasatc, cyclazocine and naloxone - and now contraphenaxina - to datarnine the best method ané turatlon of action. To of administration, their safety, assess their efficacy, we havc JaveIOpad and are the principal proponents of 'hcroin challengas' as a tool of research and of therapy. The present emphasis delivery of naloxono and is of have shown tho most promise. on the devalopmont of improved methadone - tho two compounds which �7 r. “WV—w n.q,.... "L..._._w,...._.,».~.—. ,1 Wyn -m»—._w.n~,wm-m—uw ,,V. W The work was dono for many but since January 1969 has boon up . . M... ﬂ... _ out’pationt facilities linitntions, no have your: .V—mm"- w; , v— ','r'n~wwwmw‘iww floor. 15A Bocausc of restricteé the in-pntiont staff program 20-22 beds; but expanded the outwpationt progrsm subjects. The duration of may-w and the ”.mw’nwvmvmnv 60~80 v—v on words 123 and 15A restricted to on the 15th -.— to to includo in-pntiont care is 1-3 months; szv w—u "tw out-patient, indefinito. We are now trying to wean a fow qt” Jamar-"m?“ ”v.- pationts we who have boon with u: morn than 3 years. To do so are dovoloping a special combinod drug therapy which toquires some nursing cooperation as well as medical supervision. our program admit: approximately one patient each day, and has a waiting The list principal l. of 60-100 at any time. forms of therapy and a comoon sequence is: withdrawal and detoxification using decreasing amounts of methadone; 2. Social service evaluation; group therapy; 3. Educational evaluation and introduction to v retraining; -,- r "rur‘ -— Wm n < wresaswv" 4. Medical evaluation and therapy of medical conditions; 5. Induction on antagonists (metﬁaéono, cyclazocine, naloxono); navy-tau- 6. Heroin challenges; 7. Aftorcaro, with the appropriate thoropy: rehabilitation, group therapy, social casework, and phornacological monitoring. �1 ml “7".“ ,__ ,y-uv— m-w my"- vuwwl'ﬂ-ivrrwvwx _‘ "u:r.v'T“'!‘--v-errl" -—:——mw~;—-_ ——-m‘ - ._————- 1.....— Wﬂvw—mu— In response to suggestions for the immediate future, I would emphasize that no therapy has been tested to warrant general and sufficiently indiscriminate application. despite the severity of the problem. The dengere of each approach are poorly understood and any mandatory program (especially if carrieé out lalty) will provide by untrained the basis for more harm than good. Efforts at developing better pﬁermeeologic agents, the trial of storefront. non-hoepitalcentered units for delivery of antagonists, special oducetionel unite in the especlally 1n the schools and the health centers to involve the users in the treatmont programs, and better community, general medical care of the addicted are that are logical now. A of the steps broad scale methadone-rehabilitation program should be available to project some all who volunteer. One would be the development of a long-acting neloxone. ee potentially the most useful pharmacologic tool at From the point of View of the report, we would be labelled as: Experimental-research: 60% Care and therepy: 40% Fink, M.D. Professor of Psychiatry Mex MP:kp specific this time. best � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-5-470 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/45ee8c68949569761d0dfcf0a56af617.pdf 4518143e579f97cb99e4cf642ac3ba82 PDF Text Text ”was (0,)» .v ,r ”or," "*y- v." o, -m- December 18, 1969 Dr. Alfred Freedman Department of Psychiatry York Medical College New 5 East New 102nd York, New Street York 10029 Dear A1, I have just completed two sessions with the second year medical students in a laboratory demonstration in psychopharmacology. The students were cooperative and the demonstration was successful in eliciting the powerful effects of set and expectation on the evaluation of drug effects. The schedule allowed time for discussion and in an open inquiry period, I became concerned that the students who did express themselves, indicated attitudes that are inconsistent with human clinical psychoPharmacology, as I View it. They modern drugs were ineffective, or effective suggested that only as placebos; the dosage ranges they discussed were subthreshold for the mentally ill in our institution; and there was emphasis on the toxic effects of psychoactive drugs. an inordinate of these attitudes may be derived from their present lecturers, most, if not all, being animal pharmacologists with limited clinical experience. I am reviewing training programs in psychopharmacology for the ACE? meeting in February, and as I review our programs. both undergraduate and graduate, I wonder if a more clinical, or clinical—experimental View could not be provided. Some git), best e Sincerely yours, Professor of Psychiatry HF :kp �-~ 'Mwuwut-Ivmwuvr . ‘um‘ \-.-...--.-v,~-,.V-‘.-.w.wnu-—.— —-—mv-,..~r.~.....-- my. w v . . . i V, V.” . “MWW. ..r.__ .v _ .. 5... .w- . -v—un.‘ . , a; «WV... ".7 . ﬂecember 18,'1969 Dr. Alfred Freedman York Medical College New Department of Psychiatry 5 East 102nd Street New York, New York 10029 Dear Al, I would like to recommend Dr. Alex Karczmar for your consideration for an appointment in the Department, as an experimental pharmacologist, for the research units at the New Community Mental Health Center. His curriculum vitae and publication lists are attached. I know him principally from his participation at the and CINP meetings. He is a valuable and expressive speaker, and has a good grasp of experimental psychopharmacology. He seems to relate well to clinicians, and I have found him cooperative and interested in the same subjects that interest me, ACNP particularly cholinergic aspects of behavior. While it may be premature to nominate candidates for the laboratories, I am aware that it takes up to 2 years to separate a good candidate. Alex has expressed an interest in an opportunity in New York. Sincerely yours, Max Fink, M.D. Professor of Psychiatry HF2kp enc. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-6-548 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b2a0b980fb637a972cb65a00a4feff52.pdf b7d541df8d1b5e75a2b3e61a71f278b0 PDF Text Text wry-avF'r‘rv‘w—W ‘4‘w-"m‘ ~x'--‘ Hummer-m4“ way. u- . .11. w y vw.‘ r q-«nwm-y-W-xwumuu-w~-~—v.(.-ym-M‘wa aw" u.- -N—v V.....,.-, » ,l 7-.- “w ‘ a... w . n... .‘._ m. w w“ Wm...’ a. .7". WV November 13, 1969 Dr. Alfrod M. Freedman ﬂepartmont of Psychiatry New York ﬂedical College New York, New York Dear A1, In making the arrangements for the president's reception are faced with certain decisions and I would like your judgment. we A cash bar will require eaoh guest to pay $1.65/drink. Our charge would be $35 for each bartender and I am requesting two bartenders be available. - mwwmrv-yr l ‘ :u'v’w Canapos may be purchased in one of two ways - a fixed fee of $6,50 per person for a two hour cocktail party; or our purchasing a quantity of food that we think is adequate at varying costs per tray. A cepy of their costs is enclosed. The management suggests sixteen pieces per person as a reasonable average, especially at that time of day and EOr a two hour period. I am unsure as to the number of people who might attond but estimate 80 to 100. If we accept the number of 1500 pieces and use the minimum costs, I come to $700a$800. If we take a fixed cost per person we are than dependent on the management providing enough food. If we do it by the tray, I believe I can request the managmenot to deliver more trays within a short while if the demand requires. I would like to request a variety of hers d'oouvres initially on the basis of 1200 pieces (12 piocos/person) with the proviso that we order more as nocessaxy (and funds allow). Sincerely yours, Fink, M.9. Professor of Psychiatry Socretary Max MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-6-607 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5cbb0a89bc240f2b921f1140aa2a36c0.pdf 668c2b496ae568bcd915b35a499c2502 PDF Text Text 3=/ T0: Alfred FROM: Max SUBJECT: Zelson Proposal M. Fink, Freedman, M.D. ‘ DATE: November 7, 1969 M.D. I have read the proposal and can understand the Review Committee's comments. The proposal is unfocussed; the ideas too general; and dependence on outsiders to do ”their thing” prominent. The staff has experience with opiate dependent mothers and infants and the proposal appears to have been formed by the buckshot method - try everything that sounds sood. is to help them. The focus is therapy but on diffuse biochemical effects in infants. Why these tests were selected is not clear. Perhaps they should be encouraged to focus their interest, explain their foci, and this would be useful in defining a new protocol. not warm my; 1‘1:qu I on -‘"‘NI“§"7-qw recent relevant publication most Mr. Rich and <. ( 'w 4mmv—W1-u-r ‘ Jpnﬂi'ﬁm}; Mszp ...). his is the statistician of the Department of Pediatrics is held in "um" vwwm». 1930 and lists as 1957 (1952, 1948 Asides: Dr. Zelson graduated in “awfuyam . do not know how one good repute by Don. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-6-630 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3b4f22d4ec239c5af98dce7fbe6467d4.pdf e1630671b822bb0bc01eb9677231dc4b PDF Text Text January 22, Dr. Alfred M. 1970 Freedman Department of Psychiatry Now York Medical College 5 East IOan Streot New York, New York 10029 Dear A1, its The Research Committee at meeting today was unwilling an alternate for my membership on the committee. I withdraw the suggestion. to accopt the concept of I find that I am unable to attend the meetings of the ResoarCh Committee with sufficient frequency to be a useful participant and ask your permission to resign. I would commend Dr. Stanley Foldstein, Associate Professor of Psychiatry, to your attention as a suitable substitute. Sincerely yours, Max Fink, M.D. Professor of Psychiatry ”szp cc: Dr. Lohr � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-1-015 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/adb64c4978ddaee0d2bd202aba87f8c7.pdf 17dca976d3c18c9525303520fcc4ff41 PDF Text Text -.-uﬂ TO: Alfred FROM: Max M. Freedman, M.0. February 4, l970 DATE: Fink, M.8. SUBJECT: Attendance at Executive Faculty Meeting The principal issue at the Executive Faculty change in curriculum third Dr. was the increasing weeks for medicine in the — and fourth year and decreasing psychiatry and surgery. Jaffe indicated that psychiatry in a gentlemanly fashion. great concern that this The had accepted the decrease surgical representatives voiced recommendation would be disastrous to the surgery training program. It that was my impression Dr. Jaffe's report was poorly described with inadequate support of the numbers in the proposal. He was unprepared and had many errors in On a vote On a vote insisted that the report submitted (appended) it. to table, W I abstained. to accept the report, I voted The/yote was not accepted l3 to 12. MF:kp against acceptance. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-2-068 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/616f7c418f98ba9899271780131cc325.pdf 3bb9e4c8213a8ef6b923ea8607abd7c9 PDF Text Text TO: Alfred FROM: Max SUBJECT: Fellowship Status, Dr. Jan v. Volavka M. Freedman, M.D. DATE: April 9, 1970 Fink, u.n. Dr. Volavke requires two years training credit to achieve entrance to the New York State licensing examination. One year may be in psydhiatry, and the second in another clinical discipline, 3.5;, medicine, neurology or pediatrics. For this year he requests an accredited program in psychiatry. Following our discussions, I suggest the following curriculum which, if satisfactorily completed, should meet our ”training” requirements. 1. 2. 3. Course work - any of the following: (a) Introduction to Psychoanalytic Techniques. (b) Principles (c) Continuous Case Conf. in Group Psychotherapy. Clinical Supervision ﬁr. Wolherg and Techniques of Group Supervision. ~ Dr. c. welter- Dr. E. Fried Either of the following: (a) Individual psychotherapy, (b) Group psychotherapy by Dr. Negler (and Dr. Sadock (and ~ 1 2 cases, supervised staff). group, supervised by staff). Clinical Service. Case management and responsibility for patients in one of the following projects of the Division of Biological Psychiatry. (a) Comparison of (b) Anti-narcotic activity of (c) Child Psychopharmacology program anti-depressants in PCPA subjects - Pink, Zaks. PHP - Finger. Simeon in opiate dependent ~ Simeon, LaVietes If these suggestions meet with your approval, I will try to negotiate the details with the supervisors and clinics involved. I prOpose Dr. Volavka be given credit for an academic year, 1970. MP :kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-4-202 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8c61a8f45cf81ec00512a7898d89e279.pdf a98842707517ae4b153b4865b0cfa0c3 PDF Text Text % % i 5 ‘ § 5 TO: A. M. Freedman, M.D. FR M: Max SUBJECT: Child Psychopharmacology Project Attached is Fink, a PsyChopharmacology DATE: Outober 26, 1970 M.D. report on the first year of the Child Project. patients in active treatment now, treated There are 11 by Drs. Robson and Caztanaga, Miss Formicelli, H.S.w. and Mrs. Korein, M.S.W. and Boone Durbin, R.N. I antacipate difficulties in maintaining this special unit without a replacement for Joven Simeon. In View of the need for additional staff in other programs, I will recommend discontinuation of this special project. Dr. Gaztanaga and Miss Durhin will continue in the adult program; Miss Formicelli and Mrs. Korein reassigned to the narcotic addiction unit; and Dr. Hobson should be re~assigned to Child Psychiatry, full time - with reassignment of her salary from 47—072—5 (narcotic addiction) to child psychiatry or other departmental funds. MF:kt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-9-516 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1280c2c65571f5b298a8167ca60f4a8a.pdf 8cdfff115fc4c19f2735c1799773eb0d PDF Text Text To: A. M. Freedman, M.D. FROM: Max Fink. DATE: January 25, 1971 M.D. Mandatory Consultations SUBJECT: I can think of so few medical situations that require a mandatory psychiatric consultation that I hesitate to list even these. Rather than subscribe to such a limited list, I would suggest a concept of recommended consultations in the following instances. states, particularly post-partum. (1) Withdrawal and depressed (2) Addiction syndromes, as in post-surgery or postutrauma. where a threat to life is seen. barbiturates, alcohol and opiates. requiring restraints. (3) Toxicomania (4) Recurrent surgery without adequate oathology; and other states — as "hypochondrtasis" or any severe delirium ”hysteria”. Whenever the secondary diagnosis is depressive illness. schizophrenia or severe psychoneurosis, and these diagnoses may reflect contributions to the primary iliness or to its management. 15) MF:kt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-1-031 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9156f79ed90840a02c9d77d1e804f9cc.pdf b51ccf0d619234cd9638c9a1c9e5aae3 PDF Text Text an..." TO: A. M. Freedman, M.D. FROM: Max DATE: January 25, l97l .-.. A—r.vn.-.vn~—<,w-.'.,.,-..r, Fink, M.D. Mandatory Consultations SUBJECT: w-K n ,-v~.-—.—‘—.lw- .n' .7: ~ think of so few medical situations that require a mandatory psychiatric consultation that I hesitate to list even these. Rather than subscribe to such a limited list, I would suggest a concept of recommended consultations in the following instances. I can (1) Withdrawal and depressed post-surgery or postutrauma. (2) where a (3) states, particularly post-partum. Addiction syndromes, as in threat to life is seen. barbiturates, alcohol Toxicomania - any severe delirium and opiates, requiring restraints. (4) Recurrent surgery without adequate pathology; and other as ”hypochondrlasis“ or ”hysteria". [5) Whenever the secondary diagnosis is depressive illness, schizophrenia or severe psychoneurosis, and these diagnoses may reflect contributions to the primary illness or to its management. MFtkt states � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-1-035 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a2129c7c2ca9d4194eada564789a8b29.pdf ead278017dc449bf7da18fb6480553cc PDF Text Text February 26, 1971 A. M. Freedman, M.D. TO: FROM: Max Fink, m. Chapter in Textbook, Tranquillizers in Psychiatry SUBJECT: it I have read the chapter (35.1) as you suggested, and find quite good and up~to~date. It is easy to disagree with some opinions; to suggest that the emphasis be changed, but any criticism would be minor compared to the major areas of agreement. be 80% If you wish this rewritten, very similar to Denber's less chemical, I can do article, more neuroPhysiological. it. The result will but the emphasis will be are correct in assessing an absence of data on lithium Kalinowsky's section on miscellaneous therapy is weak. You therapy. My principal hesitation is the personal conflict with Hy. Please assess the risks and to the gains, and make your decision. Mszt one of coming damage into in relation � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-2-085 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3b2dae9a138ac5e1f3e83df1108cd206.pdf cef944560a63302704db86971b7c8062 PDF Text Text --. rwmwa—w—n- *M'wmﬂ‘ﬁm'e—WV'W‘WI -- ~ - m.»- . r , Hal" W‘W"1wwn-".Vr’T-wwwvv——w< v—w'wm—WNﬁI—ﬁmmv—Hmm—IIV .. whfwrw... 7 ..._—...~ .w—m ‘—,‘ ‘ we”..— A “WT—.mwwm- - ~ “ June 11, 1971 w -v‘r>wwww'yww-w Dr. Alfred M. Freedman Chairman and Professor Department of Psychiatry ., New York Medical College 5 East 102nd Street thew York, New York 10029 ~ nmw..—. Dear A1, .«mn— . V, r .7 V I . ww'mvwwW-V'N—W ‘ s wlmwmxwmwzrw“ For the past two years I have tried to find the time to carry out my research and clinical committmants, serve the changing needs of the Department, particularly in opiate dependence, to write the henﬁsarticlea of the Division, and to write the books I would like to write ~ on EEG and drugs, on the narcotic antagonists. and on ECT. With the new services at Kirby and perhaps at.Mbntrose, I fear I will not make any progress in summarizing my data. I am writing to request a sabbatical year effective July 1. 1972. I joined the Department in April 1966 and believe I will be eligible at that time. Such freedom will allow me to join the faculty of a university center or research laboratory in Europe, where the reports could be written (I hope) and I could learn more about psychopharmacology and electrOphysiology. To make the necessary arrangements I will need the school's approval now. 'This will permit me to make my connittments. to work through our programs so they may be productive in my absence, and to plan adequate coverage for my programs. I believe my staff is adequate to maintain our programs without significant interruption. Many thanks. Sincerely yours, WW wwr-wm—r Max wwmw MF:kt 'Ta—n n... ———.—~—v—Ww Fink, M.D. Professor of Psychiatry ‘ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-5-317 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5ec205c6ef6e47799ac2c52ea1b45c9a.pdf fb05a11820af974396cc771f52479d23 PDF Text Text To: I. A. H. ?ROM: Freedman, H.D. Fink, DATEr Mby 17, 1971 M.D. Proposals for Developing a LonguActing Narcotic Antagonist SUBJECT: Establishment of a research center with its own staff. Since the leadership is in the nepsrtment of Psychiatry, such a center can be seen as part of a large program in drug dependence, based at the new Mental Health Center. Since the Center has 3 floors of laboratories, and 250 patient beds (29 already dedicated to addiction on the 6th floor), it is a logical center for such 1. research. will need funds to equip the laboratories, appoint chemists, pharmacologiats and pharmaceutical specialists, particularly The program those interested in addictions. For equipment (assuming space be made availabe at the estimating 1/2 the 3 floors. $850,000 For personnel Scientists (lst year) $35,000 staff 6 9 @ Supporting each $50,000 Clerical MEG. and 210,000 300,000 “econ- 550,000 __ ‘UWWWW‘Vq—‘W’w , Supplies 40,00n Consultants 20,000 The annual budget in years 3~10 should average $750,000, to be supplemented by special project grunts as may be needed. �. —m= For Consulting contracts to develop a silaatic vehicle, e.g., Food & Drug Research, Inc. $70,000 80,000 1970~71 1971—72 ‘80,000 1972-73 $230,000 For consulting contract, to develop physiological slow release method based on non~silastic model. e.g., Alza Corp. $300,000 300,000 1971—72 1972*73 $600,000 For consulting contract, based on oil depot preparation e.g., Dr. Pilpel, Chelsea College, England’ 1971«72 1972~73 3 50,000 m_50,000 $100,000 To develop alternate antagonists (a) M~5050_Rcckitt & Colman www.crw wv/ w l. Aiimal Toxicology §_l§J000 2. Intral w, “7—, Dose Toxicology in man $90,000 wmmrww, 39 (b) trials year $70,000—100,000 15319.29: WEN 1. 2. assay, dose finding Supplies of drug 3. Human P‘mww‘w’wrm—W" .r. Long term 1 . .iwvwwww 16,000 Supplies of drug20,000 Personnel __70,000 "v A-w $ Human clinical trial $ 50,000 50,000 70,000/yr. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-5-347 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a5af5b457865963b5019c98bb6d79efa.pdf fbebbf0cc0a14e65e075935475cfa5da PDF Text Text mn.W—mw~—wr , TO: Alfred M. Freodnln, FROH: Max Fink, H.D. SUBJECT: Dr. lain . , M.D. DATE: May ., Ww.w .n- 17, 1971 Khazan Dr. N. Khazan, Associate Professor of Pharmacology Mt. Sinai School of Hodicino, has exprosscd an interest our faculty. I have “mm..- at the in joining of his work in addiction for a few years. Earlier roferred to us for our ability to analyze his EEG tapes. Rb have had an interesting working relationship, and I bocame aware that he is studying opiates, antagonists, and cannabis. His work is complementary to our own. this year known ho was vitae is attached. I would attention, for possible referral to Dr. Lehr. His curriculum MF:kt commend him to your uunu... mxwr-va-m—u- ~ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-5-348 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4d84bf882dd122ad96a24cbdcb9871ab.pdf c9dd0b9b2df10a7d7b554bb5ac542d46 PDF Text Text v: x r 4 a. ,«Aymr :v 1.v .uwwww July 22, 1971 awnwuzzggauuu Prof. Alfred -»a1¢uuwrgnzm« u? Chairman M. Freedman Department of Psychiatry New York Medical College «tr: 4-14.” Dear Al, Re: Rhea Dornbush, Ph.D. n-.~_.menw-re .vm « raw/«mt «truism erﬂ'ﬁmiwﬂ‘r 3: Dr. Rhea Dornbush has done an exemplary job in all her assignments during her tenure in the Department since 1968, that I am pleased to recommend her promotion to AAAou'au Paaﬁuzs M. Since joining our faculty in 1968, she has described the memory effects of unilateral and bilateral electroconvulsive therapy; the effects of acute cannabis inhalation on mood and performance tasks; developed the chronic cannabis study program, assuming all the responsibility initially assumed by Prof. Stanley Feldstein; and has established the liaison with some of our overseas collaborators. I have found her knowledgeable, responsive, responsible, excellent co—worker, and recommend her promotion without reservation. and an 0. : Sincerely yours, -; «tw-vv.» r r" Max WSWVK~ Fink, M.D. Professor m. "HF, Director, Div. Biological Psychiatry mf/ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-6-388 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4d497be1b90c3433d9648577cad56668.pdf 96cadfadedd75b4d0286edeb3c9f6240 PDF Text Text v--,-—.‘ «v— ,.mmm __ ._... “.mm. OcTober l0, 197| Dear Al, i should like To recommend Richard Abrams for membership in The formulary commlTTee of MeTropoliTan HosplTal. years ago, aT your requesT nominaTed Richard Resnick; and iaTer, asked Mrs. Cruzado To lnviTe me To dome Some I I of The meeTings. These are held aT irregular lnTervals, buT The is responsible foo The assay and deTermlnaTlon of Those psychpharmaceuTicais ThaT are To be included in The formulary, eiTher on a perminenT or Temportry basis. CommiTTee i believe ThaT Dick Abrams is well qualified for This posiTlon and considering The years ThaT Dick Resnick has served, lT would be To every one's advanTage To make This requesT. Thanks. Max Fink, M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-7-439 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/73249549cd5c154bd13b2759fad8c1df.pdf 723b132fbdec8ccc43117a4136f3b9b4 PDF Text Text OcTober 9, l97| Prof. Alfred M. Freedman Chairman, DeparTmenT of PsychlaTry New York Medical College Dear Al: The following noTes are wriTTen in response To your informaTion for as To my relaTionship wiTh L. Bucci, M.D. requesT l firsT meT Luigi when T0 The DeparTmenT, and his inTeresT me To requesT his appoinTmenT To my he applied for an appolnTmenT in psychoTropic drugs allowed division. His firsT assignmenT was an evaluaTion of The duraTion and poTency of fluphenazine enanThaTe compared wiTh oral fluphenazine; and This laTer was augmenTed by a comparison wiTh fluphenazine decanoaTe. As is our cusTom, we esTablished a proTocoi for The admission of paTlenTs To The program, Their supervision and raTings, and The Types of evaluaTions required. MosT criTical in such evaluaTions, is The adminisTraTion of The proposed dosages for The proposed lengThs of Time, wiTh The physician allowed To use his judgmenT in each case as To The From The very ouTseT, Luigi had proper dosage To be deployed. more difficulTy Than Two oTher TherapisTs (Maria Fuchs and Jovan Simeon) in carrying ouT The proTocol. The dosages were more variable Than ThaT of The oTher physicians; There were repeaTed supplemenTaTions wiTh oTher drugs, parTicularly MAO inhibiTors (despiTe proscripTion in The proTocol); and The records were mainTained in an idiosyncraTic meThod. aT LaboraTory TesTs were noT requesTed as required, and various Times, The duraTion of TreaTmenT was suffciienle aiTered ThaT The drug Trial Took anTicipaTed. many more monThs Than we had AT The end of The experimenT, we noTed ThaT The evaluaTion of secondary effecTs for Dr. Bucci's paTlenTs was aT IeasT Two Times ThaT of The oTher physicians. On examining The records and The available cases, we noTed a marked discrepancy beTween The evaluaTion criTeria he used, and Those of The resT of The sTaff. AfTer considerable review, l concluded ThaT The idiosyncraTic naTure of his judgmenTs was sufficienle differenT Than �"nv -vw,mw>n~ m-w—I—H—o-w my experience To ‘iw_mwww.’. -- mm w.wmmwwwvww i,” TVWV preclude his usefulness in of The Division of Biological PsychlaTry. The ﬂ_»_r..i.,.._..........-.wv- research programs His opinions wiTh regard To The TreaTmenT of MAO inhibiTors are based on sTudies which he has published. i have read Two of These reporTs, and recall ThaT They failed To saTisfy my criTeria for an academic reporT—They were deficienT boTh in conTrols and in independenT evaluaTlons. psychoTic paTlenTs wiTh In adleion, i am aTTaching a xerox c0py of a reporT which he published from The work aT MeTropoiiytn HospiTai. i do noT recall seeing The proTocoi filed or approved, and I suspecT ThaT This sTudy was done conTrary To The rules of The school. This, despiTe, my urging him To file The becessary documenTs before a sTudy is conTemplaTed, parTicularly one ThaT is as unique as This one. On The posiTive side, i would recall To your aTTenTion his enThusiasm for Teaching and parTlculariy his drive To asserT The posiTion of psychopharmacoiogisT To The DepaTmenT. There was a disTincT dissoclaTion beTween his enThusiasm and his abiiiTy, and for This reason, i requesTed his Transfer from The research divisions and failed To supporT his requesT for promoTion. Sincerely yours, Max Fink, M.D. Professor of PsychlaTry - � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-7-449 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d5e11c294b8f4a160a76fdd9281bfa83.pdf 743446f3b5a6af58b3a028f83cfd9253 PDF Text Text III-1“ NEW YORK MEDICAL COLLEGE FLOWER AND FIFTH AVENUE HOSPITALS 70: Alfred FROM: Max M. Fink, The Freedman, M.D. DAT; M.D. SUBJECT August 11171972 Attached attached proposal for a joint study between Dr. Inturrisi and Dr. Levine is a valuable addition to our on-going studies of levo— methadyl. This information an information is sent to you for your files, and to suggest that letter regarding the collaborative study appropriate College authorities. be sent the � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-3-244 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/413f4e7c4a84c1a0c8153cb113193da1.pdf c426e20017fcf5876f432045d2ac09bb PDF Text Text F: W October 22, 1972 TO: Alfred Freedman, From: Max Subject: Request of Pennsylvania Medical Society regarding 002 THerapy for Opiate Dependence M.D. Fink, M.D. I have read the submission of the protocol (which is letter of transmittal, and testimonials by Dr. LaVerne. incomplete), Except Gﬁr the testimonials and the alleged private practice documents are devoid of the type of information required to assess the usefulness of the therapeutic studies. The program lacks a theoretic basis, and except for the spurious association between the availability of the technique and the availability of the patients in the same office, there is no justification or data, the basis for the application of the inhalations in drug addiction. Since the Pennsylvania Medical Society has already presented the information to a most sophisticated panel (Drs. Brill, Seevers, and Primm), it seems an unnecessary duplication of effort for this unit to attempt an evaluation of the data submitted. Considering the possibility of undertaking an evaluation of 002 therapy at the New York Medical College, I would not recommend such a course at this time: there is no basis for the study; the risks are great; and prior committments preclude the use of our limited facilities at this time. As a political eXpedient, referral of this agency to could occupy some of their time would serve two purposes: and effort; and if the project has merit, they have the funds and SAODAP it the connections to establish the studies in the national interest. mv � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-4-296 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0942101ba6357a12a0ca0433a6751109.pdf dbbcdbba5f07d7f493818cd0746d7f2c PDF Text Text n w-uwu—MTINaran—wmwpw—nu— - ~ u ,A -... cam-m 4“,..." ”7“. “JV“, .7 ,or, .1....,..,W.,....,,,, w" v .m-v r .. ..,. . -..... , n.7,," ‘r 17...“. ..<.. .... , V......v.,._..o..r ,. ._n 73sn~76083 1a Rovonbor 1973 Charla; 0. Rutlodga. Ph.D. Dopartnont of Yharnnoology Univotolty of Colorado School of auditing 4300 East 9th Avenue Denver. Colorado 80220 Boar Dr. Rutlndzo: I ll planned to submit this letter of recommendation on bdhalt of Carolyn V. Poiolor. who has worked with on since Juno. 1972, following her graduation tron Colby Coll-go. graduated with I major in biology and did eopc~ oially wall. but aha also to on without I specific toouo of interest. This laboratory is dodtootod to the analysis of tho changes produoud In tho scalp EEG of man by prolunod and actlvl poyohonotivn agents. Th. facilition include Grass polygraphs. FM tap. roootdoro. and a dodicotod IBM 1800 con— onto: for data rcduction. Hi work with voluntonr waist to ﬁxtondod obocrvatlon aoaoions. Candy Candy has learnod how to interview voluotcoro. obtain a analyst this quantitativoly aging all of the dot: tuduction oqulpnont, and to nuunarlso and «walnuts tho data. In addition to £36, oh. has loornod how to obtain Ilood can» plan. take blood pressure. ond-noot 1mportant-to maintain a profounionol attitude with subjects which inaptroo oonfidanco and their cooperation dospito aioconfort. fine EEG, This work has boon going on in my liberatory since 1959, and Candy has been one of tho two most outstanding students thnt I have had. Sho has always mnintalnad hot point, is moot plea-oat to work with, is enthusiastic and completely roliablo. .A , . u: 'mm-‘m‘wwbmaruﬂr'fﬁ‘ﬂv .;;. Now—r .. 1 �mW—wwmw-Wﬁ.w.n‘wp.ww_. Dr. c. 0. Rutloégg 7w w mu“,- -2- ,, ......,.. ..,.._._ ,_ _ WW aw. . 7— ._._ m. ,_» V 7. a... .. 16 Novonbor 1973 Horn 1: not for the fact on to graduate eduottion. that I onoourago my antistnnts to I would rcgrot bar dociuion to but I loava. an gratifiné that the has seloccod n fins ins stituuion in which to continua hot graduato studies. I In ploasod to raconnnnﬂ bar without roaorvation for go you: graduate study program and hi»! assurod her tho: I would b. dolishtod to havo hot toturn to work with no at any ttno. Sincerely youru. ﬂax Fink. M.D. Professo: of Psychiatry MF/oin Encl. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-4-319 Date A point or period of time associated with an event in the lifecycle of the resource 1973 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a8f1b9f9b2d255ae5ac26db9807a012a.pdf 07ea608de68d61362aac2522839d3e59 PDF Text Text 4-4 - v-r-.—- ... we» yrs ~ ',w":»“ xv»- 2‘ an" «nary-w umwﬁﬂmwxmmn: ' V av. we-mxn-p.»... m , . ' _ ,, . , . turr- mun- we— ,7 , ”new: AM)». wranwm a“, a«ww—nvv~;.~~w-W»-wmqgm. " '- - W'v.ﬁr—"~Vwﬂn‘l<mﬂw“ August 11, 1976 Alfred New New M. Freedman, M.D. York Medical College York City Dear Al, I have just read the report by J. Fishman, "Preparation and Evaluation of a Sustained Naloxone Delivery System in Rats" which appeared in the journal Pharmacology 13:513~519, 1975. It is excellent and suggests that a long acting formulation of naloxone is feasible. I commend the article to you. have sold the house in Setauket and returned from a trip through Great Britain (for a nation with such beautiful countryside and and exciting heritage, why can they not learn to cook food tastefully ? ?). We're busy with college preparations for the last of my children and anticipate with some optimism the next year We long at SUNY. My regards to Marcia and Irv. Sincerely yours, Max Fink, M.D. -,,1- 1w“.— � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-4-194 Date A point or period of time associated with an event in the lifecycle of the resource 1976 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8c65c0df72470b995d4e45e7bc93e867.pdf 68cc8d6ad57de7e195ea13cc15ee99c8 PDF Text Text May 19, 1978 Alfred New New M. Freedman, H.D. York Medical College York City Dear Al, I trust the food and wine. meetings in Paris were as good as the While you were away. Dr. Tai (? sp) called from Stamfbrd with an interesting question. What criteria should be Hospital who on the staff is accredited to administer decide applied to ECT ? The same question was asked a few weeks earlier by the physitian in charge of New Rochelle Hospital. The Task Force report does not make a specific recommendation. consider a request to the American Board of Psychiatry did but and Neurology to establish accreditation criteria. As I recall the discussion (as told by Fred Frankel) of the first Trustee review, we this item deleted. was personal suggestions to Dr. Tai, indicating standards of accreditation that were applied at his hospital for physicians carrying out similar difficult skills in treatments that carried similar risks (e.g., anesthesia, surgery) should be applied for physicians requesting approval for BOT: evidence of preceptorship, a number of treatments,given under his control, knowledge of the principles of BCT, and skills at treating Since criteria of this kind have the emergincies of the treatment. not been applied heretofore, I suggested he may want the umbrella of your Departmental recommendation. If he should get in touch with you, this note will explain the basis for his seemingly odd request. that the I made some same My regards. Sincerely yours, Pink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-029-2-080 Date A point or period of time associated with an event in the lifecycle of the resource 1978 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/932ec023bb323691e41499fcffdd12cf.pdf 781d34dcf72b8c3e3104bfca09db38f8 PDF Text Text Department of Psychiatry and Behavioral Science Health Sciences Center State University of New York at Stony Brook Stony Brook, New York 11794-8101 telephone: (516) 444-2990 ’— StonyBrook / ﬂ 2 September 30, 1985 Alfred M. Freedman, M.D. Department of Psychiatry New York Medical College Valhalla, New York 10595 Dear Al, Thank you for your kind invitation to join the distinguished Board of Editors of Integrative Psychiatry. I am pleased to accept your invitation, and look forward to supporting the aims of the journal. My best regards. Since ly yours, / Max ' ,M.D. P essor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-030-6-159 Date A point or period of time associated with an event in the lifecycle of the resource 1985 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c6e304285f33acfe06bfd3841973b14f.pdf 794178b37b23090db46a4d01f891dd43 PDF Text Text May 23, 1987 Alfred M. Freedman, M.D. IPMS Department of Psychiatry New York Medical College Valhalla, New York 10595 Dear Al, am unclear about the mission of the new International Association for the integration of Psychiatry and the Medical Sciences (IPMS), I am pleased to work with you on this project. While 1 In the latest number of CONVULSIVE THERAPY, I have written an editorial about the increasing interest by neurologists in behavior and of psychiatrists in brain function, with the re-emergence of neuropsychiatry (under the code-name of Behavioral Neurology). Indeed, it was only yesterday that 1 proposed the development of such a journal to Alan Edelson at Raven Press and recommended that he consider inviting Michael Taylor to develop such a project. ‘ Perhaps we are responding to similar awarenesses, with a slightly different emphasis. in any case, I look forward to hearing more about the forthcoming meeting in New York of IPMA. ‘ My best regards. Sincerely yours, Max Fink, MD. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-031-1-032 Date A point or period of time associated with an event in the lifecycle of the resource 1987 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1b7c311e29708cd9889a15b5bd01cf42.pdf 63b3086d3d101f8b0f029bac11fcbcd1 PDF Text Text “'r'wwn'w" MF’ WW~w——,nu -..v v ~ , IF: , v—w rmw—mwuuf - -—m-wm"l‘v-—lwv-L’-‘V"V. May 30, 1988 Alfred M. Freedman, MD. Professor 5: Chairman Department of Psychiatry New York Medical College Valhalla, New York 10595 Dear Al, Enclosed is a copy of your nomination for the 1988 McAlpin Award. it may be helpful if another letter is sent. If you will suggest names of leaders outside the Department who may also send a letter, i will contact them. I think of Leon Eisenberg as a long-standing friend, or Milton Greenblatt. Have your secretary call me at 516—3“ 2929 so that icon do what needs to be done, before the end of June. My best regards. Sincerely yours, Max Fink, MD. Professor of Psychiatry . . » WW»; Ww— vu't—u'r -‘ - . -1“ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-031-4-086 Date A point or period of time associated with an event in the lifecycle of the resource 1988 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/51a56978c9119713597544e56eb2fca5.pdf e37cca292e7ba2b0a6617670bc179dd0 PDF Text Text October 26, 1988 Alfred M. Freedman, M.D. Department of Psychiatry New York Medical College Westchester Medical Center Valhalla, New York 10595 Dear Al, The advertisement1n the March issue of the British Journal of Psychiatry caught my eye; hence my note to you about an article on ECT. Perhaps the editor moved the article to a later issue. was sorry to hear that the recommendation for the McAlpin did not materialize; we should try again. I Meanwhile, I have kept up with Lothar's progress and plan to see him tomorrow, as I am coming to New York after a month's travelling. Turan and I presented our work at the international Pharmaco-EEG meetings in Kobe, Japan. He did well and he has many loyal students who attended the sesssions reliably and enthusiastically. My own impression (it was my first trip to Japan) was that I had never seen such a fine organization nor were my questions answered so quickly and so well in more than 35 years of attending national and international meetings. Our hosts were most solicitous and the meetings were quite good. Martha and l travelled about, from Kobe to Osaka/Kyoto/Nara by trains, finding them prompt, efficient and generally clean. Language was no problem, and we thoroughly enjoyed ourselves. lam sorry to have missed the program in New York. My trip to the Netherlands (seven lectures at seven universities in five days) was an educational success, mainly because I learned much about the politics of medical care in a socialized society. It was enough to turn one into a confirmed reactionary. As for Australia, I you anyway for your help. My do not see myself getting there in the near future; thank best to Marcia. Sincerely yours, Max Fink, MD. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-031-5-115 Date A point or period of time associated with an event in the lifecycle of the resource 1988 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1e26ed9421235cf234ff20825881a678.pdf 60103dc96c835d0ee7ef11ae63b32de9 PDF Text Text October 18. 1967 Dr. Danie? X. Freedman Chairman, Department of Psychiatry University of Chicago Chicago, Illinois Dear Dan. Itii wiii be pieased to participate in the symposium on psychomimetics at the forthcoming ACNP meeting. Enclosed is an abstract which summarizes the data which we would iike to present. 0r. and I Thank you very much for your invitation. Sincerely yours, Fink, H.D. Professor of Psychiatry Max Mszp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-021-7-407 Date A point or period of time associated with an event in the lifecycle of the resource 1967 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0f3426694cfee43a551abc910187ac65.pdf 63b6a9af148bc3b276d6a97f342e1c0d PDF Text Text March 28, l968 Dr. Daniel x. Freedman Chairman, Department of Psychiatry University of Chicago 950 East 59th Street Chicago. Illinois 60637 Dear Dan. Sol Goldberg has written asking that I send you copies of the enclosed reports which have recently been completed. These have been sent to Dr. Nittenborne forinclusion in the Proceedings of the ACNP. It was a My best regards. l967. pleasure to participate in the hallucinogen reports are published soon. symposium and I hope the Sincerely yours. Max Fink, M.D. Prlfessor of Psychiatry Mszp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-1-007 Date A point or period of time associated with an event in the lifecycle of the resource 1967 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9366768cca31720a3877ba9cea29a99e.pdf c5d6a3751567487f415098156592d5ae PDF Text Text \. March 28, l968 Dr. Daniel X. Freedman Chairman, Department of Psychiatry University of Chicago 950 East 59th Street Illinois Chicago, 60637 Dear Dan, Sol Boldberg has written asking that I send you copies of the enclosed reports which have recently been completed. These have been sent to Dr. Wittenborn forinclusion in the Proceedings of the ACNP, l967. It was a My best regards. pleasure to participate in the hallucinogen reports are published soon. symposium and I hepe the Sincerely yours. Max Fink, M.D. Prlfessor of Psychiatry MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-1-018 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/410e86570bfa5534c75d7a6f4bcc2a40.pdf 0c29a81a8630b78302b2c75234ab3bb0 PDF Text Text __ “an.“ 1... «pp-FTEYWYVW : ‘krw‘wwkuw‘wm.~y— -|--. v v .7 -. We m . , «4.455.... .. .,—,-r,w.- ,nvr many"... 7,... . . . ”a,“ .7... “WWW,“ , ‘ “harm-w. .. 7......_,‘,.» March 25 , 1969 Dr. Daniel X. Freeman Professor and Chairman Department of Psychiatry University of Chicago School of Medicine Chicago, Illinois Dear Dan, It is a pleasure to enclose reprints of our reports in the edited by Dan Efren, recalling the splendid meeting of two winters ago. The assignment gave me great pleasure and has been rewarding in ideas for our continued research effort. new volume Recently I met your associate, Jack Green in our mutual roles as Chairmen of the Computer Committees of our respective facilities . His novel views of narcotic antagonists were of special interest. The differences in emphasis between our Department under Al Freedman and the existing facility at Mount Sinai became grossly apparent. Dr. Green seems to be involved in the selection process for a new chairman, and is less acquainted with the research and comnunity action programs fostered by Al than would be desirable. In your discussions, a description of these programs, from your vantage point, may be nutually useful. My best regards . Sincerely yours , Fink, M.D. Professor of Psychiatry Max ME’:kp enc o e , . , “v“. v . ,, .... v, —w.. "—7 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-2-180 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/10c404525ded516355fcead7cbc34113.pdf 4bf9f0ef98ad8e0e0902ae7e9ac928d9 PDF Text Text v- vujl~mrw -‘m‘,-"«".‘-mh" M- u» 1m" um~-w>mvms~s are-w.“ w-M ssh-w- ~..v ~u——.~ ~-m4ﬂ~ nul‘amawr— \ 'Ilra'm ‘ an... 7,: - ,wq,.maa--mxu.n w-m‘wvﬂmn...».- <,pn- 'If-rl'rr tum: October 23, 1970 Dr. Daniel X. Freedman University of Chicago Department of Psychiatry 950 E. 59th St. Chicago, Illinois 60537 Dear Den, For many years, I have maintained an interest in ECT. When unilateral ECT and MHECT were suggested as procedural modifications which may improve the treatment process, we undertook a detailed study focuased on the behavioral u neurophysiological inter" relations. The data has been most consistent with the theories of ECT based on Weinstein and Kahn'e studies. I am pleased to submit this report for your consideration for publication in the Archives. Many thanksfor your consideration. Sincerely yours, Max Fink, M.D. Professor of Psychiatry MF:kt enc . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-9-525 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/953d5c55968daba7513b7c0a288ef17e.pdf cf56a6199cc18edeee5ef604cb886cdd PDF Text Text F." ~ 'rnmwl'wme-vmamn-m-v\‘Jm'ﬁrwﬂﬁVFW m t f . ' V mm- .:.,_,.,...vv.."... mm 3“ ‘Nr‘ February 4, 1971 Dr. Daniel X. Freedman University of Chtcago Department of Psychiatry 950 E. 59th Street Chicago, Illinois 60637 Dear Dan, Some months ago I submitted our report, "Unilateral and ECT; Effects on Memory, Depression and EEG” for your Bilateral consideration for the Archives. May I My (Your manuscript 0658.) ask for a status report on your review? best regards. Sincerely yours, Fink, M.D. Professor of Psychiatry Max Mszt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-2-158 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4cf6372845708c63cfd5d23444a0a865.pdf 3662c05f557a11536255f95751a7e7ec PDF Text Text May 12, 1971 Dr. Daniel X. Freedman Chief Editor Department of Psychiatry, University of Chicago 950 East 59th Street Chicago, Illinois 60637 Box 2011 Dear Dan, RE: M83 0658 Revised Thank you for your letter and critique of our ECT study and Bilateral ECT: Effects on Depression, Memory ”Unilateral We feund the suggestions cogent and the Electroencephalogram“. and we have nade the following changes and revisions. 1. In addition to the multivariate analysis, a description of the pre« and post-ECT mean depression scores is included. 2. The classification of patients into endogenous or reactive clarified, and reference to our unpublished manuscript groups has been deleted. 3. a The sources of bias of concern to the reviewer (non-random assignment, non~blind assessment, concurrent drug therapy) are discussed more fully in the text, 4. We now clearly each treatment . and then noted in the Synapsis~Abstract. state that each patient 5. The study of Strain gt_§g;, importance. is now had a grand mal seizure accorded a more proper 6. The sections on EEG and on memory are reduced to a few sentences summarizing work reported elsewhere (Brit. J. Psychiat., Die. Harv. Syst. ) . 7. We and ask My The time of post-treatment evaluation has been clarified. would be honored to have that you reconsider this this report appear in the Archives revision. best regards. Sincerely yours, Fink, M.D. Professor of Psychiatry Max MF:kt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-5-360 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a0859579aa9ebfea6022fb35ff74a680.pdf 1d89e768c07f6b0239fc247c726201f8 PDF Text Text Tﬂyvy, July 22, {Viv—V7. «ml—m— ».. er... “my” 1971 Dr. Daniel X. Freedman Editor, Archives of General Psychiatry 950 East 59 Street Chicago, 60637 Dear Dan, submitted our report, "Unilateral Effects on Depression, Jemory and the Bilateral Electroencephalogram" by Abrams, 23 £1, Is it possible to obtain the recommendations of your editorial board ? and Late in April we ECT: many thanks. Sincerely yours, Fink, M.D. Professor of Psychiatry Max . w v1v7 » .r...~.;;~ t rr ... vol, n» a. m , 1 ~ w � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-6-381 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/257a1d0809ade480dca67688ebd55df3.pdf 11e796136b9f97086e4a86d7aa16e91b PDF Text Text October 21, 1971 Dr. Daniel X. Freedman Chief Editor Department of Psychiatry, Box 2011 University of Chicago, 950 East 59th Street Chicago, Illinois 60637 Dear Dan, are enclosing revised versions of our report "Unilateral ECT: Effects on Depression, Memory and the Electroencephalogram". we have redrafted the results section, following the cogent suggestions of the reviewers: We and Bilateral (1) found the patients responding to drugs instead of ECT? difference in clinical effects between unilateral Are We and bilateral treatments to persist after statistical "adjustment" by regression analysis - and have described our data more fully on page 8. our (2) own Are differences suggestion (P8. due to age or not? we try to answer on page 12-13. We were unable to 11—12) assert that age was a contributing factor to the clinical difference in unilateral and bilateral HOT. (3) Confusing pages 8—9. restructured the presentation - Critic is correct, we issues of this study are important, and to contribute to the discourse. The Again, my and we have believe more clearly. we would be pleased thanks for your consideration. Sincerely yours, Fink, M.D. Professor of Psychiatry Max Mszt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-7-424 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a6c4553e41644a6267038d4f7309d8e0.pdf ca0b7e6a698a15f01f233c0287893b6d PDF Text Text P- we? March 10, 1972 De. Daniel X. Freedman Professor and Chairman The University of Chicago Department of Psychiatry 950 East 59th Chicago, Street Illinois 60637 Dear Dan: It was a pleasure to discuss the opiate antagonists as a model for the treatment and prevention of Opiate abuse, and it may be useful to outline some issues of interest. Neither cyclazocine nor naloxone, as now formulated, are prac— of opiate dependence. At best, we have been able to sustain a select group of Opiate users with cyclazocine for up to 5 years, and some are now drug free __ but the number is small, and I believe our success to be as much a result of the dedication of my staff as to any specific pharmacologic activity. But these experi~ ments demonstrate that the antagonists provide effective narcotic blockade; that they are safe; and that tissue tolerance does not develop to the antagonistic actions. They also indicate that drug delivery ~~ a sustained delivery of weeks or months -- is the immediate hurdle to overcome. As the bnger duration of action of methadone and levomethadyl make maintenance therapy feasible, so too, a prolonged acting antagonist would make both deconditioning and phophylaxis clinically realistic. tical in the clinical treatment From this point of View, there are thcee practical problems: the development of a long-acting delivery system; identification of more potent additional 'pure' antagonists, of greater duration of action; and, biochemical synthesis methods to assure an adequate supply of medication. ,crn �Dr. Daniel X. Freeman March 10, 1972 - 1) Long-action. There are many routes that can be examined substitution of a long~chain fatty acid to delay absorption and degradatiOn (similar to fluphenazine enanthate and naloxone pamoate); modified crystallizations (as utilized by Janssen for a long acting antipsychotic drug); investment in a biodegradeable silastic (as suggested by the Population Council for anti—ovulatory agents); or other novel altered delivery systems as developed by some ingenious chemists for ophthalmic drugs. We have supported one study of silastic and defined the charmethod using naloxone as the base. The study was acteristics of this discontinued for lack of funds. It warrants continued support, despite the long term nature and potential expense of the investment. We have also completed observing that 6 initial human assays of naloxone pamoate, cc intramuscular prolongs the duration of antagonism diacetylmorphine/chlZ minutes (a 'heroin challenge') to 60 an increase in duration of at least 15 times. This salutary demonstrates the feasibility of the approach. step to 25 hours mg —~ A long~acting 'pure' antagonist. 0f the tested drugs, nal— the 'cleanest' compound, hut it has many disadvantages a" its is duration of action is 2—4 hours; it is ineffective on oral administra— tion (we required 3.0 grams to extend duration to 24 hours); and it is expensive and difficult to manufacture, limiting its supply. Other compounds warrant testing, and of these M 5050 has the most promise, based on animal trials. To test this compound, it is necessary to first complete adequate animal toxicology. (This step has precluded human 2) oxone assay for more than 2 years, for no agency which we approached was will— ing to provide the funds. Happily, funds were approved on March 3 for these trials). In addition to this compound, there are many others that war~ have been examined by the University of Michigan for antagonist potency, and these data are 'hidden' in the archives of the NRC/NAB. At the request of various agencies, Dr. Vil~ lareal nas agreed (February, 1972) to undertake a review of the data; and should other compounds be identified, these should be assayed in man, with particular emphasis on their 'purity', degree of antagonism, and duration. rant study. Many compounds ' Under the have returned to compounds. This Sterling stimulation of Congress, various industrial concerns their laboratories and examined their files for active is true for Merck (levellorphan), Bristol (BC 2605), Winthrop (ﬁ-cyclazocine), and Geigy (GPA 2163) drugs warrant more intensive examinations. -- and these �March 10, 1972 Dr. Daniel X. Freedman Finally, perhaps an interested scientistwith experience in analgesics, could be encouraged to visit various laboratories to dis— cuss on an individual basis, the availability of compounds or congeners in their files. When this was recently done with Janssen in Belgium, we were able to identify two possible compounds of interest, and to stimulate their further study. 3) Biochemttal synthesis methods. The basic chemicals from which these antagonists are derived are in short supply, apparently because their manufacture is derived from thebaine, a proscribed commodity. Some effort should be made for chemists and botanists to iden— tify other manufacturing methods and other sources of the raw materials. In this review, I have neglected the need for training psychi- atrists and clinical pharmacologists in the special problems of studies in addicted persons (patients usually have a different agenda than the scientist); the need for studies of the extinction of learned patterns; and the need for the studies of the dependence process itself. These general issues are of special concern to the committees of the National Institute of Hental Health, and will surely occupy the attention of the new proposed centers. In our discussions of the ways in which these studies could attract the attention of scientists in universities and industry, one suggestion may be of Special interest. Should an agency, preferably non~governmental, outline the needs for a long acting antagonist, de— fine a reasonable deadline, and offer a prize of significance, would this not stimulate those men who may be unable to visualize the needs of the formulation, to attempt its development? Should an agency offer $50,000 or $100,000 for the development of a narcotic antagonist, with a duration of a single administration of 60 days, sufficient to block~ ade diacetylmorpnine 25 mg/2 cc/2 minutes, in man «s would this not stimulate some interest? (An example is the announcement of the Anna ﬁonika Foundation prize). Two additional needs: support for academic scientists to work directly with industry on a 3»6 month 'fellowship' basis; and support for regular meetings of investigators interested in the narcotic antago onists, similar to the annual methadone meetings. (When we suggested the methadone meetings set aside time for the antagonist workers in York and in San Francisco, our suggestion was denied. The only special meeting was sponsored by NINE and the New York Medical College on June 4, 1970). Nan �{I Dr. Daniel X. Freedman March 10, 1972 These are some random notes. Should you be interested in the' will provide what I have. Meanwhile, my latest summary as prepared for Contemponaty Dnug Pnobﬁeme is enclosed. 'back—up', I Again, my thanks for lending ye your ears. My best regards. Sincerely yours, Max Fink, M.D. Professor of Psychiatry HF:ig Eﬂnc; � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-026-1-052 Date A point or period of time associated with an event in the lifecycle of the resource 1972 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/46bc44935e4f2be123125360f2d34c71.pdf d7bcb3ad5427d25702cedf398126d903 PDF Text Text 7483-02683 18 January 1974 Dr. J. Silvio Clinical Drug Studies Section National Institute on Drug Abuao National Institute of Montal Health 5600 Fichct'o Lana Rockvillo. Maryland 20852 Door Dr. no.i silvio: HSM 42—73*260 wish to report that during tho quarto: October 1 to In averaged 19 patients each month to tho about drug trontnant facility at tho Notthport VAR. The majority adminniono tho of unto multip1o~drug abuoorn, including abuse of wu Docombor 31, 1973. alcohol. In the third wook of Novunbor. tho fit-t patients word in— ductod into tho lovomothadylwnnthadonc cooperative study, and on Dacoubcr 31, nine pationto wort inducted into the study. No difﬁtlultico or aid. offsets have been oboctvod, and acceptance of this ttoatnont rcginon has boon good. During Doccubot on dotoxifiod thtco patients in anticipa~ tion thnt ooltrczono would to availohlc. Supplies not being availablc, those pationto have boon roinductod into methadone maintcnnnoo. two Staffing tannins unchanged, and on are activoly recruiting additional counselor: for tho expanding outpaticnt part of tho program. Attached is a table dcactihing the caucus for this quarter. Sincotcly yours, Fink, H.D. Profcuaor of Psychiatry Max MF/cis Att. cc: D. R. Charlton � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-5-411 Date A point or period of time associated with an event in the lifecycle of the resource 1974 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5567705354a2d30a0a284e2a2e0956bd.pdf 01971674e7ad69303851e070b1e77282 PDF Text Text www 7m. ,7 v x . .z-mwmnm m November 5, 1976 Daniel X. Freedman, M.D. Chief Editor Archives General Psychiatry 950 East Chicago, 59 Street Illinois 60637 Re: Ms. #QORM (Revised) Dear Dan, Enclosed are two draft copies of the revised version of "Efficacy and Safety of Induced Seizures (EST) in Man". The draft reflects an extensive revision and my attempt to answer the inquiries and suggestions of the reviewers of the earlier draft. I trust this approach is useful to the profession. My regards. Sincerely yours, Pink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-4-179 Date A point or period of time associated with an event in the lifecycle of the resource 1976 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/2a46f94557dc9e8753652971ec14dfd4.pdf 1e0270711ed0b50bce18d46ccfac3775 PDF Text Text August 2a, 1976 Daniel X. Freedman, M.D. Chief Editor Archives of General Psychiatry Chicago, Illinois Dear Dan, On my return Re: M8 ##024 from my holidays, I found your letter of 26 with the critiques of the paper”Effioacy and Shfsty of‘lhduoed seizures (EST) in Man? I cannot say that I am surprised, for I have become accustomed to unusually sharp criticism of any report that I write on EST. But I did find many of the comments useful, and taken in the spirit of improving the product, I shall try to correct some of July the omissions and the errors, as well as add a section of clear critique of the status of our present knowledge. I do think that the last request is for an additional paper, but perhaps the addition will not be too large WW“? v .1.-r.y"-',-¢v -_— pwqwm'w «serum-man“. -~‘I: "a, wuwr‘ “In."- 7., and may be useful. In your letter you indicate that "I have decided my initial reaction is off target - I enclose a letter I wrote; I also enclose Noch Callaway's response." Neither your letter nor Noch's response were in the package, and if you still think these would be useful in re-writing this report, I would be grateful to see them. (I received critiques I to V). I have some specific questions for reviewer # 2 (begins 'I appreciate the timeliness of this review, esp. . . . '). He argues that the issue of the comparative efficacy and safety of EST vs. antipsychotic and antidepressant drugs is not dealt with till at all. I thought that I have cited the principal articles in this regard; would it be possible to ask whether there are other citations missing? If the criticism is that the presentation is poor, then I accept that criticism and will re-qrite it; but I do believe I have cited the most relevant articles. I also find his statement 'there are hints of the possibly overly sanguine clinician—enthusiast in some parts' helpful, and have attempted to take a more judicious posture. this In any case, it will take a few weeks of extra-effort, but means a delay to get the text back to you-- probably early October. My thanks go your My regards. to write such fine critiques. I .m many busy researchers Sincerely yours, r-m—vm-v ’..1w:' who Max Fink, M.D. took the effort � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-4-196 Date A point or period of time associated with an event in the lifecycle of the resource 1976 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/36806ca03b4ef00e70d2a5c1dae72295.pdf 147597a152e3782b79a2ed04afc7d5eb PDF Text Text v ”A .._, V yum-awn ».-- rmnwwmwrw ryrt’ww‘wwtwtvmj January 3, 1977 Daniel X. Freedman, M.D. Chief Editor Archives General Psychiatry 950 East 59 Street 60637 Chicago, Illinois Re: Ms “02% (Revided) Dear Dan, In re—reading the draft of the article, "Efficacy and Seizures (EST)in Man", I found a number of Induced of Safety of the discuss-on and comment (pp. 30-35). I in the text errors have corrected these, and in the event the article meets the standards of the Archives, I ask that you use this draft for publication. Thank you a healthy 1977. for your consideration, and my best wishes for Sincerely yours, Fink, M.D. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-5-255 Date A point or period of time associated with an event in the lifecycle of the resource 1977 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a20a723e3cf52207317e49c1c84de002.pdf 371d087eddc702900a2a88dcb2f71ead PDF Text Text February 3. 1977 Daniel X. Freedman, Chief Editor M. D. 4;; Arehivas of General Psychiatry Department of Psychiatry / Box 2011 University of Chicago Chicago. Illinois 60637 Dear Dan: It is to be forgotten in a check the status of busy office! Evy I ask you to 91:02:; (Revised): “Efficacy and Safety of. Induced Seizures Many so easy for u report (EST) in thanks. Min“? Sincerely yours, Fink, M. D. Professor of Psychiatry Mb: MF:fg M (iii;//w � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Daniel X. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-029-1-049 Date A point or period of time associated with an event in the lifecycle of the resource 1978 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/30f8c02cf29bb4670c8628047fb08655.pdf 4bcd43d4c581f05697642633a02a1cc4 PDF Text Text ‘7": ,.._..v_ Auzust 8. 1975 Mrs. Marilyn Freedner 28 Strathmore Road? Great Week, New York 11023 ~ ‘ \K‘J i Dear Mrs. Freedner, I thank you for your gagigg orticle. So comments on the Saturday far, the experimental peptiies are in trials in seizures (convulsive theraPY) and in elderly patients with 'normal‘ forgetting. Should these patients fOIIOVing induced continue to be successful, I have every expectation that the experiments kill be broadened to other population samples. For the mnenwhile, the rules of drug research prohibit trials in individual patients with disorders outside those for which trials have been approved. Sincerely yours, Fink, M. D. 'Professor of Psychiatry Max ; hFer � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedner, Marilyn Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-028-2-127 Date A point or period of time associated with an event in the lifecycle of the resource 1975 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/57a6ff2a948d3e9a768b373a029295db.pdf faca506f9dc65866d5081e77928f48a8 PDF Text Text April it, 1966 m. Alfred New York New York, H. W Meal college Fifth Amua at 106th Street New York 10029 DearAl, Afterywleft,m.mld0vammoanedmandcamto mymomatll:00p.m. Wesatmddisemsedhispmmmtil befomtm 2:00a.m.m1feltﬂmt1hadmgetmmst smimmﬂmday. I Whimaself aasmdandoompetmt Hamvinwdhisstudiesmllmdgavemacloarpicm m. ofamtinportantmaaamhpmgxm. 'me mly diffiml‘ty in micatim appeared to Mate to hispmwﬂpmmmﬂhisemmlmls. Whehasspent mtﬁmwithputimtsmdmuldlﬂmtomnﬁnminmtigaﬁms amarienoatocbﬂﬁsmdmuldliketheopportmitymlm. in patimt populations, he indicates that he has inmfficient Iietaoldmhemsoffemdmogportmity tomrkwithcmrlie Shagass, butstatodtnwouldpmfepmininginﬁewmxk. kgiwstm mama imam alsoakmsamdandadeaimmdavelopapmgmaepamtefm myprojectleacm. misbemclmmraspdceofmtmtming towerkuithkoy,ﬁmlmfeltma"tigxt"smp. of desiring to in m arr-going program but Idesmihadmymsmdypmmbutmenlhadtomclaw that itmtndtakabetmnaixmnthsmdayearwangoptindsﬁc) befmmoouldmasmblyhawmequipmntmthepemml mamtoomtinuewstmias,mmdicatedﬁmthemededa positimmwandltoldhimthatImuldmlayﬁwfollowingtoyou. Ifmmpmgmminpmmss,mmdbeavalmbleasaocim. especially because om could assign general qmstiona to him with the optimim that m might a resolution with the flair mush Plowmamlasshemuld ﬁmtlwhasatminhiaearliersuﬁies. MamnimshipdthFOyIdomtthmkthatmmasmmblym available for such studies the aquipmt, or pommnel . If Immmdyouholiewﬁwtmmmfmdsmaquipmr labamtuy,ﬁmn1mﬂ.dsuggestyouspeaxmiouslyabmthaving space, himjointhestaff. mmopizﬁmistm'thiaapplimtionis 18~2Hmthstooear1yforﬁwmsmdthedxugaddictimpmm. �Dr. Alfred M. Madam -2- April a, 1966 If, however, you would like to have him participate in the and if independmt ﬁnding might be forthcoming studios mmry for that program, than we should be able to discuss this with him. I raised the question and his was that he was mm interested in alectmphysiologioal methods than in mummy function stmias at this point. mat I loftthesuggestionwithhimﬂnthewastogetintouoh withycu, orywwithhimwimintranaxt twwaeka. Iwould also like to say ﬂat "I would like to confirm my inpression both with RoyandHagarBridgerifyoumuldliketogoa‘madwithan I do mt want to call Hagar unltss you are atmgly inflmncad to nuke and! a oomdtmnt and if you an cmsidering it, I heliavo we swim discuss Dr. Overtm'a oollahoretive abilities appointment. with Roy and Hagar. Sincerely yours , Pink, MD. Professor of Psychiatry Max MF:kp P.S. He did tell an that Dr. Rosmhamn had just 00:10le a contract with Alan Miller for research space at Bronx State Hospital, ’a control. He traught this was pmaunably moor « basic science space and not patient care areas! -e � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freeman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-205 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b60f9893012fa6df8a4b8678abbd1001.pdf 0f6e7c41dd644d9a7e1dbd22c2bbefe7 PDF Text Text Department of Psychiatry and Behavioral Science Health Sciences Center State University of New York at Stony Brook Stony Brook, New York 11794 telephone: (516) 4442990 StonyBrook ' October 7, 1983 Dr. C. P. L. Freeman Senior LeCturer in Psychiatry University Department of Psychiatry Royal Edinburgh Hospital Morningside Park Edinburgh EH10 5HF Great Britain DCarDrr-Freeman. .. -» _ 7 - »; r' ."monthTedrd“revrew-“theteachingew-vMauwwactivities in ECTin this country. I have organized a workshop at the next meeting of the American College of Neuropsychopharmacology (December 13,1983;Caribe “ ' Hilton Hotel, San Juan, Puerto Rico). The session is focussed on similarities of biochemical measures in ECT (and ECS) and antidepressant drugs. At the 1983 meeting of the Society of Biological Psychiatry meeting, I gave a special address on the history of convulsive .theraP)’, anticipating the 50th anniversary on January 2#,'1984. The next president of the Society, Dr. SarwerFoner plans another special lecture be given at the 1984 meeting, to be held in San Francisco in May. He has invited Professor Jan-Otto Ottosson to review the history of theories of the mode of action of convulsive therapy. Each year, at meetings of the American Psychiatric Association, we have held a panel on clinical issues The sessions have been organized by different leaders (Trevor Price of Dartmouth University and Richard Weiner of Duke University in 1983). I do not know what is planned for May, 1984 in San Francisco. I believe that Trevor Price and Ari Albala (University of Michigan) are planning a teaching workshop. There is usually room for volunteered papers, either in the regular program, or in the special sessions of the Society of Biological Psychiatry. The section of psychiatry of the New York Academy of Medicine is organizing a special 50th anniversary meeting on ECT on February 2, 1984. Richard Abrams, Fred Frankel, Lothar Kalinowsky, Sidney Malitz, and Iare among the invited speakers. This is the schedule of meetings, as far as I know it. There is nothing scheduled for November, 198# that should be in conflict with your program. If you are interested in coming to the U.S., let me know when you believe your data will be in good shape, and I will try to recommend an appropriate forum. �Dr. C.P.L. Freeman ' _ October 7, 1983 Page 2 talking with Dr. Crammer, in reply to my question regarding texts for that you had written a manual for ECT, published and distributed by Smith Kline 6: French Laboratories. He did not have a copy, nor was one available at the Maudsley Institute of Psychiatry library. 15 it available in the US. ? If not, how can I get a copy ? In ECT, he said The furor about ECT is now muted, and more and more, I find the medical and lay communities approaching the use of ECT with a reasonable, questioning, attitude. There is more research interest, both by clinicians and basic scientists, and we are optimistic that research funding will be available without the thorny issue of ethics muddying the review process. Our principal concerns are not the electricity/seizure issue, but the efficacy of unilateral electrode placements and brief pulse stimuli. The Royal College report by Pippard and Ellam has been very helpful, in suggesting that usage in the US. is not (relatively) excessive, and that technical questions, particularly the monitoring of seizures, need special attention. Thankfyouforjyour letter, and my best regards. Sincerely yours, 744% Max Fink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freeman, C. P. L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-030-4-090 Date A point or period of time associated with an event in the lifecycle of the resource 1983 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/78b62a687d6eb111680f67d63ea51dd6.pdf ff1df94df111f513135a632372fc73c0 PDF Text Text February 13, 196‘ Dr. 3. Freeman Racecrch Director Medfiold State Kospital Hadficld, Mall. Dan: Dr. Freeman: Dr. Violet Sunder Baa, of Fakiatan, has applied to than: laboratories for the position of a rcuearch psychiatrist, and has indicutcd yea it I roftrance. I would be grataful for any information that you mny be able to give an regarding Dr. Das' training, row snatch abilitiuu, and intern-ts. Theta labaratorias haw. placed an enghnaiu on clinical psychiatric tcsunrch, and I would be lost interaotcd in Dr. Dns’ ability of connnniantc in a program with our pxychitttic population. Thank you very much for yen: coapcration. Sincercly yearn. Fink, Director Max NF/jb M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freeman, H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-1-121 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d38711c049ca72e9f17140d60661625f.pdf f0b228e48c3d05a30255cf73e16a3dda PDF Text Text . . -“n wuss—“mpg..- “n Irru n (7W ‘rraw- .ﬁw v‘Il‘ ovum—u: “MW-r - :w r,..,.-u--. r: a «‘ixﬂm“.m'*w-WVF:V*P w I‘W'wlrw wmmwmvruns-s- )Fr-l'iw.n:'.' 'n'rnv—vrvmv-r— "Wm-A- January 14, 1971 Dr. Hugh Freeman Hospital Salford M68HD, England Hope Dear Dr. Freeman: It was a pleasure to have you visit our laboratory. Concurrently received the proofs of the contribution to Shagass' book, and I The citation (#13) to am enclosing a copy of that galley proof. T. Rothman is listed as: we Changing Patterns of Psychiatric Crown: New York, 1970 Care It is obvious that we hold a favorable opinion of the role of formulation, and concur in your interest. My regards. Sincerely yours, Max Fink, M.D. Professof of Psychiatry MF:kt enc. Galley (Kargel) this � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freeman, Hugh Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-1-050 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/336f2aba4669b5e577520ca4e943f7b9.pdf 5041acdcc2db1db5eec73e3b957a78fe PDF Text Text April 9. 1965 7w- .~ —.- ﬂ- v Wm. -: v --__.,, “m u ;.—.. .v-rw. W Wt unity “minim Wu MW m- $1.1M 3' Mm Tamara Gonna. 730 Third New AW York. M York and Equities mm mm. mm: of Autism ' 10017 Mthomwv-nityafmmw Mcimhuhoenmlu. IWWMWWWity badmtpddﬂmwimfwhmmymﬂmmmt mashed. Immuhtmhtoﬁnutmumofﬂu Metataratmncm.,mhamwmm Ithpmbabhtmtthofirst uni-Wham. will «float tha for the first 1.»: mm M W Wthiammhﬂaﬁp. ' Myouvmnym-‘wdting tom. Simmly. Max W333 ﬁnk. 14.1). mum. mmtw � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Frenchman, Sheila S. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-2-194 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/07a0426b772c70194b30e0728bdc6f6a.pdf 840c631c207734709ec8f53f8e29d888 PDF Text Text April 28, 1965 Sheila S. Madman Prunim Mrs. Team Association of Marion Imam and Amnity Collage Ratixmnt Rand 730 New Third Awnm York, harm. New Equities York 10017 Madman: Itavoﬁlodtlnpmmmwimﬂnlhivomity ofrﬁsmi.mdﬂuyhaveaarudtocontimoﬁwmity payments to TIM, effective May 1955. than, the payments for the April. 1965. will not be 1. months m. Par thia year, of February, Hard-1, am Simly yours, Pink, Md). Executive Director Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Frenchman, Sheila S. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-019-2-231 Date A point or period of time associated with an event in the lifecycle of the resource 1965 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/39099b255d48a29b4dcecfd71707e631.pdf 93d714bafefe8cb4687fd5055fab2c8d PDF Text Text September 28, 1970 Dr. J ack Preund A. H. Robins 1407 Cummings Ave. Richmond, Virginia Dear Jack, Dr. Pierre Simon has candidly cnswered my inquiry regarding the enclosed articles. I have read them, and tend to agree with Dr. Simon that the data is uninpressive. It is particularly disturbing that the "best" results are in cases in which other drugs were simultaneously given. sulpiride, and sent me I am disappointed with Borenstein's had a chance to read the than his earlier reports. If useful to I data, now full report. These data that seem you, I will write to Dr. Nourricier. will send the other reports, as I receive them. Sincerely yours, Fink, H.D. Professor of Psychiatry Max Mszt I have less rigorous � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freund, Jack Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-8-398 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/ea9cef0c902bde7e53a34d9e1027884f.pdf cbcd38a374f07061a269cf9a18d90526 PDF Text Text E g E E E August 3, 1970 i ”“5“ "-1-“. W ""‘ﬁ'vmfﬂdr'd’aJ'Fu-JKWu'yy‘n-w Dr. Jack Freund, Vice President A. H. Robins Company 1407 Cummings hrive Richmond, Virginia 23220 Dear Jack, I have read the reports on sulpiride (Dogmatil) with interest. data consists of translations from French of 17 clinical studies and one animal assay, published 1968-1969. The principal clinical reports of Borenstein gt_§&; (Ann. Med. Paychol., 1: 90~99, 1968; and 2; 560~74, 1968) are frequently cited but are lacking in this The collection. In the continental manner, case records are cited in general terms and it is difficult to assess the data. Four groups of patients have been treated: schizophrenia, depressive psychosis, depressive neurosis and neurovegitative disorders. I found the reports of Collard (1969), Mathey gt §£;.(19693 and Naviau (1969) best for clinical material, and that of Borenstein 33 a1. (1969) for an animal EEG study. From these data, it is probable that: l. sulpiride, 300-1600 mg/day, is an agent, with alerting and stimulating features; active antipsychotic 2. it may have less potential for parkinsonism or seizures than other active antipsychotic compounds; 3. it has antidepressant activity, particularly in agitated, elderly patients (Renault. 1969); and, 4. it has some anti-vertigo activity anxiolytic features in neurovegitative states. and may have other citations are difficult to interpret, since the reader is faith in the observers (it is assumed that they are known, or that their clinic will carry the weight of authority behind the observations), and controlled data are not presented. These asked to have �-"-~“"W«W"‘ "‘N‘”V~w- "W- \"n' s ' u . ~ . ‘YW‘WV1”'WWx-r4umw"‘ﬁwa-H'll'xw'va u.1~~r)'w'-UL-rwwmuw—-V". -.wo-u~.~u-‘_..,ru “—um-v-uwr WM!" n; ,1 < anvvnrurv- "yur'""b.'z my...“ -2- Dr. Freund August 3, 1970 I have known P. Borenstein since 1958. He is an able electroencephalographer and clinician. He is dour, carries a heavy burden of studies, publishes often and has well trained European assistants. In Liege, in Harch 1959, I heard him discuss a new, all-purpose psychoactive compound, with well defined EEG activity. I don't recall the name of the drug, for he told me that the compound was not available for American studies; but I believe it must have been sulpiride. His enthusiasm did not get a good reception, since many in the audience were preoccupied by other new compounds, chiefly pimozide and fluspiriline, two Janssen compounds in early clinical trial. (The conference was in Liege with Janssen support, and many of the participants were his investigators.) Collard’s report is also a good one. I know the director of his choice, Professor Bobon, as well as his son. They are enthusiastic and probably able psychoPharmacologists, and perhaps these observations should be treated seriously. . If you seek another psychoactive compound, the data of these studies are sufficiently supportive of a broad spectrum antipsychotic (and antidepressant?) to warrant further study. It also has interesting anti-vertigo properties to support its antipsychotic potency. I would suggest Borenstein's initial reports he read and his present views be obtained. Also, the present views of Collard and to visit these centers, to discuss the clinical material in detail, and to assess comparisons with other active compounds in the same clinics. In the case of Borenstein, it would be interesting to review his EEG material. Bobon and Naviau. It may be useful I am attending the CINP in Prague in midsAugust. As this is a biennial Opportunity to discuss new compounds, I have checked the list of titles and sulpiride appears only once. J. M. Sutter, g£_&l;, of Marseille are reading: effects of a new drug: ”Controlled study of the psychotropic Sulpiride.” for the opportunity to review this material. It that I should take better notes at huronean clinical meetings, and will try to do so. (I am returning the translation separately.) Thank you reminded My me best regards. Sincerely yours, Max Fink, M.D. Professor of Psychiatry MF:kt cc: Dr. Tabor � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freund, Jack Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-8-456 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/2b6c4d46bee7a7f4db631f985a44155a.pdf b60beb1da740c8e3634a624112404d04 PDF Text Text v "In-1"!- October 14, 1970 Dr. Jack Freund A.H. Robins Co. Richmond, Virginia Dear Jack, I am enclosing a copy of a letter from P. Bornnstein and the reprints that he sent in response to my request for data on sulpiride. In reading the papers I find littla that I have not read before. The EEG data is, unfortunately, non-quantitative and less than definitive. to My interpretation of this data is that it adds you posed regarding sulpiride. clarify the questions little I trust this is helpful. Sincerely yours, Max Fink, M.D. Professor of Psychiatry mf/ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freund, Jack Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-9-545 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f9277c6ff06cc427f7062a336cd6f88e.pdf 42a24f89e995312d229bb4cf570f462a PDF Text Text January 14, 1971 ‘Dr. Jack Freund A. H. Robins Co. Richmond, Vtrginia Dear Jack, Enclosed is an answer from Paul Janssen to about sulpiride. It is of little help. Separately, I received Stille two my inquiry reports about clozepine from is a pharmacological review and indicates that clozapine has distinctive activity on a variety of tests, interpreted by Stille as characteristic for antipsychotic drugs. Angst gt 5;. is a clinical report in 126 patients with diagnoses of acute schizophrenia and mania. The essay is presented as a demonstration of the applicability of the collaborative, computerized data collection and analysis system, so that much of the text is devoted to technical features. But they are impressed that clozapine has distinct antipsychotic activity with two important features: no effect on muscle tone (i.e., no parkinsonism) and a marked improvement of sleep disturbances. The separation of antipsychotic and parkinson features is considered sufficiently novei as to become the basis of a test of the accepted theory that all antipsychotic drugs must produce parkinsonism. Clozapine is Dr. Hippius. and Hippius described as not having antidepressant or antimanic features. If these data are verified, the compound should be active. refer to a comparison with laevomepromazine and with thioridazine, claiming that clozapine is at least as effective an antipsychotic as these compounds; noting also that it has not been compared to the They piperazine phenothiazines. An additional report not available to no ArzneimitteZ-Fbrschung 19:496-498. 1969. It sounds like an interesting compound the reports of sulpride). My best. is Gross and Langner, (better perhaps than Sincerely yours, Max Fink, M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freund, Jack Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-1-052 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/557c1f00db9b7408bcf2134f42d8f843.pdf 282fe7036d2087da3c83bef7845dc890 PDF Text Text March 5, 1971 Dr. Jack Freund Robins Company 1407 Cummings Richmond, Virginia A. H. Dear Jack, have been very interested in the use of narcotic antagonists in treating opiate dependence, and since 1966 have carried out clinical studies with cyclazocine, naloxone, methadone, and £~alpha~acetylnethadol. Last fall I was asked to summarize our data, and in conclusion, I attempted a justification of the logic of the need for a long-acting formulation of an antagonist. We I believe that the methadone maintenance ”solution” to opiate dependence is politically expedient but not a long~term solution. I am concerned with the question of, "After a patient is on methadone, what next?” "Is he committed for life?" The antagonist model is theoretically elegant and clinically feasible. are committed to continuing our studies, have contracted with Food and Drug Research for some help; and would encourage others to experiment with other antagonists and long~acting formulations. wi We Incidentally. our experience with narcotic antagonists has led us to think of antagonists to other drugs of abuse, notably alcohol: and we have recently carried out some studies to determine the degree and duration of alcohol antagonism of propranolol. I trust the enclosed reprints are helpful. Sincerely yours, Fink, M.D. Professor of Psychiatry Max MF:kt � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freund, Jack Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-3-243 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/752f2868dc436b62afbc6cf2cbca6894.pdf d74968955d9fc2880d9627fdfab848d1 PDF Text Text October 1‘6, 1966 Dr. A. J. Frey Sandoz Pharmaceuticals Hanover, New Jersey D7936 ’- DearDr. Prey: MseofusmnIBvemtommﬂidtmingthe pastfewyeara, feelagmatdcalofsomowathis untimely death. On many occasions, we have discussed I have clinical and experjxwmzal psydnpramacology. He was a found these discussions most stinulating. tradition. gentleman in a very fine Enopean My associates and I will be glad to! participate intlneatablishnentofaednlarshipfmdinhism ,andwilldoso,ifyouwillimica’cethepmperfm. Sincerely yours, Pink, M.D. Professor of Psychiatry Max mfkp cc: Dr. m1}. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Frey, A. J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-7-451 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/de75f5f68b3bb0147cad1599103e27c5.pdf f665e6cd6f9f97ade115cbd51594acff PDF Text Text Ely 8. 196% Cliuienl Nauropharuncology Racetrdh Cantar Williln 8:. Aa‘Whlta building Eltadb¢Eh Hospital Whahlngtan 20, D. C. Boar Pritn: I have just rceaivnd a lectsr of inquiry from Dr. Joseph slap, inqunsting that I racounnnd bin for luuboruhip 1n the CERF. while I know that charm is no formal ruquirument ﬁhﬁt nlﬂbetv Ihip in the 01!? be ltniuad ta naubern of the national locioty, are you an: limiting nuibershtp 1n the C!!! to those already bsaona numbers of the next? If not. I shall send ya» a formal latter vacuumending Br. Slap. Sincerely yours. H” Fink, Dictator Dir/3b who huvn M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-018-4-367 Date A point or period of time associated with an event in the lifecycle of the resource 1964 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/edf4c0c77033475e0e9dbd8ac5c7bef0.pdf 6e634c94cdade7e6f992ae6ce1893c5b PDF Text Text AuguAt 2, 1968 0L. FLLtz FLeyhan Eston, CompLehenALve PLuehLatLy 3t. Uanent' 6 HOAthaL neon FLLtz, I am with Lego/cc! to the manuLcLLpt Mug ChLoLdLazepodee, aLone and combLned, "ThLonthane and Ln SehLzonhLenLe PatLentL" umLeh you have eonALdeLed (on pubLLcatLon Ln the jouLnaL. In checthq Lame copLeA Lent to me bu 0L. HoLden, I 5Lnd that thEAQ have eonheetLon dateL thch nLeeede the one Lent to uou 60L youL conLLdeLatLon. To avoLd any eLLoL, I wouLd appLecLate youa estoLLaL aAALLtant cheekLng the capu Ln noun handL. 0n the Aecond page, we have manhed the dnagt cap” and the date. The LateL copy, Lon youa conLLdeLatLon, LL manhed "10- 5— 67". An eaLLLea dhaﬂt, maahed "V: 5- 27- 67" AhouLd not be eonALdeLed. I5 you have the connect capo, pLeaAe dLALegaLd note. I5 you have the eaLLLeL dnaﬁt, pLeaAe uuLL bend the Latea dnagt meedLateLu. at a LhLL caLL mu oﬁgLee and we I LegLet the LneonuenLenee, but a eonthuLng teLatLonAth mLLeL haL Ltz handLeapA. dLAtunce 05 1100 SLneeLeLu uouLL, Max FLnk, PMOKQLAOk ”.0. 04 PayehLatLq � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-022-4-384 Date A point or period of time associated with an event in the lifecycle of the resource 1968 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3a87941b763b62bbca894acbaedea3b3.pdf b036f3c5c0383a99565545effa64ece1 PDF Text Text vApril Dear A, 1969 Fritz, To confirm the sense of our didcnee sue yesterday, I an taking the liberty of expending the suggestion: ».de for the 1970 progren.~ ‘ of unilateral ea“ bilateral electrode place“ may seem to .e a trivial change in the treatment procedure, but the data are .eet intereeting. The clinical results for either placement are not similar. but behavioral change is accoupenied by defined differen» a in memory functions and in 6N8 effects. The oheervatiene eve useful in understanding the relationships between memory function :od outcome; between Chg effect: and memory; and in supporting theories 0 =he node of action 0f induced convulsions described more than a deceo ago. ment The problem for convulsive therapy deny yonng contributors to the field, including (HY), Blathly (Oregon), White (Ky), Keelhling (HY)‘ as well as a fine group in the United Kingdom. There ere Snell (Indiana), Abra“. (Ohio), Strain A ogrnn dedicated to the contributions of these authors, with e' interpretation of the observations for our understanding of the convul. ve therapy process and the treatment of affective be consistent with the aims of the 1970 meeting. The time disorders, such a review may he at least 4 hours, and perhaps, if neceeeary :.r some Engl ~h authors are induced to come. even longer. Such an allocation of time ran the regular program may be unjustified, and perhaps a useful solut . may he the holding of a concurrent tension either on the Thursday. befov: or the Sunday after the APPA. p w , i The financial arrangements for these speakers and the additional expeneee of hotel end publication may be defrayed by Federal or private granting authorities, since the subject has not yet been covered in any national meeting. I have an HIKE contract for the �4 ' ..r.-v-.ar.m~>a_w w. ”ﬁx 4R ~2- Freyhan April 4, 1969 . , m, . , _ .ww’vrnurﬂﬁn... evaluation of unilateral and mnltﬁilo monitored ECT, and I believo that the agency directors would be sympathetic with such a suggestion. with the New With regard to the hotel arrangements, I am proceeding York Hilton and plan to go there this week. my best regards. Sincerely yours. Max Fink, M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-2-146 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/03dfc70293d65a29c26cd7a66197ddb8.pdf f89bd8bf5dfca19d23e905e248c13ee0 PDF Text Text March 4. l969 Er. Fritz A. Freyhnn St. Vincent's Hospital l53 Nest llth Street new York, new York lUOll Dear Fritz, It was kind of you to participate in our resident training program. The residents, as well as my staff. enjoyed your discussion very much, and I hope that we will have an Opportunity to continue this type of dialogue. With reference to your letter about the APPA, I share your feelings. In addition to the suggestions in your letter, which are important procedural changes, I think we must_rsappraise the role of the members. The younger members are discourages from submitting titlns, for they sons know that the programs are dictaﬁndle. Our sense of participation is frustrating and the only connection between ourselves and the society is an identification with the leaders. Since these change annually, there is little time for them (or ourselves) to develop the relationship which would encourage participation. No organization has over succeeded in maintaining its membership when it has been autocratic. Another aSpoct is exposure. The present ways of advertising the program soon to be inadequate to achieve the kind of attendance that we wish. This, despite the fact that we had more than lOO requests for programs prior to the meeting. The subject was an important one, the sneakers were excellent and yet, as I look back I would admit that I contributed little to a successful public presentation. Perhaps it would be useful to most discuss these ideas. My host regards. at your convonétnco to Sincerely yours, Fink, MOD. Professor of Psychiatry “3X ,ME:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-2-216 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/08760638f240849d2816bba34e257602.pdf f254d75e8f56e3fc8857c71e0dc3bc73 PDF Text Text .. uwn "w w —' wwvvz- smwv ~ —-- 1w ,mea-vv- H'L-ﬁu‘s-Rﬁr: -u.'1u—)Ir-» .| vn-n“ mvmrwmzmmz-v-wwx wr-Wm K‘C,'>~I!4‘_“ Dr. um Fritz Freyhan New York. mus-news 5, I 'W.‘"w1“"'l—' Wam'\nv. , "rrww um.- a'wru—ruu-v w evv war» ' ‘Ilv‘ mea' 97" 1969 St. Vincent's Hospital 153 West 11th Street Dear New York 10011 Fritz. for the suggestions are pencilled in novel approaches or data. My The program format APPA and is quite satisfactory. reflect opinions as to Robins probably presents a more general overview than Ninokur. For discussion of neurophysiology, both Perez-Reyes relevant and novel data than Gershon. and Bnyder have more For an overview. Roth and possibly Dewhurst have more active interests and relevant data than Grinker. The meeting My place is shifted to the New York Hilton. best regards. Sincerely yours. Fink, H.D. Professor of Psychiatry and Secretary Max xi." —_. ran May ‘4’“ --v ' Mszp .ﬂ , , � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-3-316 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b0389c901bcd1e90f40486271c9bdebd.pdf f4331db08bfd480a6e89ad4d0efcad83 PDF Text Text August 20, 1969 Dr. Fritz A. Preyhsn ' St. Vincent's Hospital St. 153 What 11th New York, new York 10011 Dssr Fritz, IBM order shoots for the NYMC and tho 1800 computers. The differences in St. Vincsnt Hospital be and in memory may significant for programming, and speed rocounondstion that programming changes for our for: the basis Enclosed will take some srs the effort. sincerely yours, Pink, M.D. Professor of Psychiatry Mix erkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-4-343 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f3707177c5ac5e22dcffa8ebe244c8ce.pdf e5f82e1e81e7546828e2c552e20bae29 PDF Text Text August 6. 1969 Dr. Fritz Freyhan New York. New St. Vincent's Hospital 153 West 11th Street Dear York 10011 Fritz, Enclosed are some notes and the reprints I borrowed The budget may be too big. but represents the true costs today. It can be scaled down. of course. and I can suggest where paring might be done. it from Dr. O'Connen. Thank you for the opportunity to read. what is to me, s new and interesting aspect of psychiatry. I trust these cements are helpful. If you are able to pass the em on to a granting agency, fees are SSO/hour end this required about 5 consulting Ache ours. My best to Dr. O'Conne'ii. Si ncere'ly yours . Fink. M.D. Professor of Psychiatry Max HF:kp enc . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-4-377 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/775438ff6afdecefe4203b4e8ea6c7ac.pdf 2df8ad5751ccc46d9b1efb9bf6fcc24f PDF Text Text October 24, 1969 Dr. Fritz A. New York, New Freyhan St. Vincent's Hospital 153 West 11th Street Dear York 10011 Fritz, enclosed letter was received. I subscribe to one of the journals, Telemetry Journal. it is well done, and perhaps, considering their unusual guarantee of $1000/year and the history of problems with Dr. Stratton, we should put this item on the 1970 agenda. The Sincerely yours, Fink, M.D. Professor of Psychiatry Max MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-5-448 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/40682ec10a5e9c3b3f0a71e4ef22c1ee.pdf 74919371fa9bff2b8f80be2525b1d150 PDF Text Text «mm» 'Jrr-V‘ z—rr—rm m" v—- -.rwrv: 17—. mn.‘wm~.r wv _ n- ~ w-Wn—z bnlw'm'rm-w' mmrnfm—Eww.m ‘7va.- October 6, 1969 Dr. Fritz A. Freyhan St. Vincent's Hospital 153 west 11th Street New Bear York, Now York 10011 Fritz. Enclosed is a final draft of our rape:t “ﬁftycloserino Tharapy of Psychosis by Symptom Provocation” for your considcrntion for Compaehenaiva Paychtatay. Should the other reports interest you, it will take more editing to put them in reasonable condition for publication (and more time). my best ragards. Sincerely yaﬁrs. Profhssor of Psychiatry HF:kp mu? 1m-..- -r Pp—swuvrv. . ”.m— � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-5-486 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d979d53399363d0ccb1ac2f80adbd6c5.pdf cd2c985ecb7aab993e12ddc0a13db7b0 PDF Text Text September 2”, 1969 ... “KW”, my", n A . -7 Dr. F. A. Freyhan Department of Psychiatry St. Vincent's Hospital 153 West 11th Street New York, Dear New York 10011 Fritz, Attached are some notes regarding the ACNP symposium would suggest I training in clinical psychopharmacology. some simple answer to number centers of of a a telephone survey psychoinstruction in clinical questions regarding the typeandof residency The principal levels. pharm at the undergraduate how any, if texts, often, who teaching, does the question is on and format. Copies of my notes are attached and these may form the basis for an outline which can be used for a telephone survey. Sincerely yours, Max Fink, M.D. Professor of Psychiatry MFtkp enc . �CLINICAL PSYCHOPHARMACOLOGY SURVEY Undergraduate New York NYU Columbia U New York Med. Col. Albert Einstein Cornell - Jersey Philadelphia New Durham, N.C. Boston Rutgers Temple Penn. Duke Howard BOU. New Haven Baltimore Yale Hopkins - Minneapolis San Francisco Minnesota Houston Baylor Langley Porter Stanford Residency / / (P.I.) / I / Hillside ?Analytic / / / / / / / / Instit. Menninger Univ. Minn. Postgrad. / / / �A. B. How is it taught? l. Lectures - 2. Care Conferences? 3. Role of Detail Topics Covered How many? Who gives? men — Chemistry Pharmacology Animals Physiology Man Neurophysiology Pharmacy Toxicology Indications — clin. psychiat. Management problems 1. Selection 2. Dosage Schedule 3. Toxicity corrections Combinations (synerg., antagon.) 1; . Rel. to clin. psychiat. - part or separate h. Literature 1‘. Experimental studies & history J. Textbook k. Attendance - elective or compulsory? � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-5-501 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/fe16dcd85d51705a56b416ff9356f1d0.pdf f5119e7410728f47278f01b24e4fa80a PDF Text Text . rsnwxwww W»WWW","tau v-vu—u-u-r,wwxm-m—wg—ww. I’w' («warn-w. r: m,W'a-‘was‘u- . .., .- . . w...” ._.. . .. <_ wwpwpw—e- m-.. _. September 9, l969 Dr. Fritz A. Freyhan St. Vincent's Hospital 153 West New York, Dear llth Street New York lOOll Fritz, Enclosed is our report "d-Cycloserine Therapy of Psychosis for your consideration for Compaehenaiue Psychiaxxy. This has not yet been edited by Dr. Itil. He plan to go over this on Thursday and if there are any corrections these can be made out within the next two weeks, if the report is by Symptom Provocation“ acceptable. also enclosing interim report "Acute EEG Effects of With the appropriate figures (which are now at the artist) and some corrections in the text, this could be prepared for publication by October l0. I am an Heroin and Naloxone in Man". After talking to you, I realized we have a third report is being revised and may be of equal interest. This confirmation of a paper written by Pitts and McClure in the New Engzand Jamal: 05 Medicine may be of even more interest to your readers. which _ Also enclosed are some notes from Dr. Donald Scott regarding device for monitoring EEG in patients in coma. He is using this in patients with cardiac arrest and it may interest you. a new Sincerely yours, Max Fink, M.D. Professor of Psychiatry Mfzkp EROS o .u. — wrap- W‘Adn-u Inn-1"". N," V-.." nun-m— . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-5-520 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/50f2890c5a2a8be917ca6b09737619ac.pdf 9c35ee88194fec7ce190380887a5a96c PDF Text Text November 13, 1969 Dr . Fritz Freyhan St. Vincent's Hospital 153 West 11th New Dear York, New Street York 10011 Fritz, In making the arrangements for the president's reception are faced with certain decisions and I would like your judgment. we A cash bar will require each guest to pay $1.65/drink. Our charge would be $35 for each two bartenders be available. bartender and I am requesting Canapes may be purchased in one of two ways « a fixed fee of $6.50 per person for a two hour cocktail party; or our purchasing a quantity of food that we think is adequate at varying costs per tray. A copy of their costs is enclosed. The management suggests sixteen pieces per person as a reasonable average, especially at that time of day and for a two hour period. I am unsure as to the number of people who might attend but estimate 80 to 100. If we accept the number of 1500 pieces and use the minimum costs, I come to $700-$800. If take a fixed cost per person we are then dependent on the management providing enough food. If we do it by the tray. I believe I can request the managmenet to deliver more trays within a short while if the demand requires. I would like to request a variety of hors d'oeuvres initially on the basis of 1200 pieces (12 pieces/person) with the proviso that we order more as necessary (and funds allow). we Sincerely yours, Fink, H.D. Professor of Psychiatry Max 3F:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-6-605 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/42f475599362ff4d8c85691ee15f1504.pdf 29192899c7c0a4a92544606ec882bd39 PDF Text Text November 7, 1969 Fritz Freyhan Dr. St. Vincents Hospital 153 West 11th York, New Dear New Street York 10011 Fritz, Please sign the card two account my office. Many on the first line statements,as President, and and the them to return thanks. Sincerely yours, Max Fink, Secretary MF:kp M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-023-6-627 Date A point or period of time associated with an event in the lifecycle of the resource 1969 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/fdb71d981666e308f8d4e49c3626725d.pdf de5c28ea306068091705c9c410e097c1 PDF Text Text .. . - two ...x..m~-...w—n;(—7.... ~......—‘w,“..-W.—ww-vw,.., .w ‘e'-‘ v"... 1,... ~....r~wu4-.r ... .- . : ‘. mmr-u 7W v.—.,_—vi,..,._.,~, ‘ V ,,..,_ 1““!m'n-mevI-Iv‘r-"w- A- ‘ v < January 1, 1970 ~w1;w.W1an-vwv :I‘V'J-v 1. «a "wwwsmww. Dr. F. A. Froyhan. M.D. 153 West 11 New - Dear Street York City Fritz, It was kind of you to invite me to portioipato in the District Branch program in March, and I vary ouch regret that I will be in Denver during the neck of the noeting. I have discussed the problem with A1 and he concurs in the recommendation of our associate, Dr. Arthur Zakn to complement his presentation. APA Dr. Arthur Zak: is an Instructor in Psychiatry in the Department. Since 1966, when he was a resident. he has been intimately cosociatod with our studies of oyclazocinc, heroin, noloxonc and mathadono. He is fully acquainted with our data, add has attended the rcccnt meetings of the HAS-NRC committee, no that he is fully acquainted with the work of other investigators. (Incidentally, he is also a yrincipcl in our studies of cannabis). I underntcnd the proaontation in on March 12 at the Academy of Hodicine. I will anoint him in the preparation of his roport, and am confident that he will do a commendable job, in doocrihing tho ptoocnt approaches to the treatmcnt of Opiate de~ pendonce and a vino of tho future. with particular emphasis on the development of a long acting naioxonc. ‘A'W‘I' .' .m .vww .- rwm-w,s.-;m:ywm van-YT mmxvm . 1571909. '7.) an .7: “FHP' veer. ”.31; 4'1 Im- Incidentally, for the January prosontation (Halon), A1 recommends Dr. Myron Denholtz as a discussant. Dr. Denholtz has been a student of Wolpo's and 13 an activn participant in our programs. Sincerely yours, ﬂax Pink, M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-1-045 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/bde0ae0b55272f765aafe48e8db0e6d8.pdf dba05ae8431bf2a5f8a34107710e36d9 PDF Text Text rum ‘T‘iw-vﬂ“ n,‘ «w - - wine-1m :‘.‘$-uu)' y 'u; “4.x"; wmmmwsw.weuwy:+_a~‘ruw.’v¢-K'Wru-‘v<'wV"”rr:u‘|.n-'T~WIW rv'vww‘ «Mm m I("'arlyF‘-,vv - 1 .77; . '."~'-".‘—— r ., rm, November 19, 1970 Dr. Fritz A. Freyhan St. Vincent's Hospital Street 153 west 11th New York, New York 10011 Fritz, Dear correction for the ﬁinutes will trust the record reflects our discussion. Your For your information, I have asked the information regarding the Editorial entered, secretary to make journal. It is clear that Sincerely yours, 7"“.w—u—vﬂ. rm.p:" Max 3.” mm, .., MF:kt w ‘- P"»"WF'uI/D—v~ c » -‘uTmM' Fink, M.D. Secretary < me I Board of the ,- ~1ﬂm'wmwmguv‘mr and the journal is a creature of Dr. Stratton, that the designation of "official journal" is nominal. In view of the other changes at Grune & Stratton, it would be useful Councillor) could review if you (as Editor-in~Chief and an APPA APPA and suggest to the the relationship of the journal to the which would perhaps establish publications committee a course the journal truly as the "official journal"? and Vnr'M‘I—v' my be .—.~ 7-. ~34." � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-024-9-479 Date A point or period of time associated with an event in the lifecycle of the resource 1970 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/88ca70f4e89800ccf8f36cf818cfe23a.pdf 2113b31741f5e9470c92f049a33fd9bf PDF Text Text February 26, 1971 Dr. Fritz A. Freyhan St. Vincent's Hospital 153 West 11th Street New Dear York, New York 10011 Fritz, Thank you for the Opportunity to read the report "An EEG Loss During Alcoholic Intoxication" by Freeman, Goodwin and Othmer. For the reasons described in the attached Study of Memory critique, I find the report unacceptable for publication in its present form. The subject is an important one, but the contribution is too inconclusive to merit the space. I believe the authors have better data ~ I hope they do, in any case ~ and that could be the basis for an acceptable report. Sincerely yours, Fink, M.D. Professor of Psychiatry Max Mszt 0116 o � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-2-086 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1b9f074b76be5097f76d868118348fa0.pdf 3f62bf28b03fff73c903beabefc364be PDF Text Text wwww‘rr-wx‘ 1‘ w,- um. .z-w- vvvwm.mw: ‘m‘ . ' >— , Wmv'm~om'-rummwr 7.72:» --vv February 9, 1971 Dr. Fritz A. Freyhan 153 West 11th Street New York, New York 10011 Dear Fritz, I am most gratified in the Council of the for your confidence. me by the support chat you have given APPA. I wish to express my thanks I would be honored to join the editorial board of Compnehanaiue Paychiaxay and shall do my best to support the traditions of the journal. My best regards. Sincerely yours, Fink, Secretary Max MF:kt M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-2-141 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6985222800b4350c029eafdc653d5101.pdf 229a02fe3b46e90299ee77bf2f5c0f6c PDF Text Text February 1, 1971 Dr. Fritz Freyhan New York, St. Vincent's Hospital 153 West 11th Street York 10011 Fritz, Dear as I New I was honored by the Association's election as Secretary, by the renomination. It was specially kind of you to am describe my service as secretary as particularly useful to the Association, for I have tried to exercise the responsibilities of the position to the continued growth of the organization. If the services have been of such merit, perhaps three years is sufficiently long to judge whether stewardship should be extended. It is unclear to me why the Association insists on longevity in some positions and not in others. Nevertheless, I have found the position of Secretary regarding and interesting, but no longer challenging. While I would be honored to continue to serve the Association, I would not appreciate another term as secretary. Among the complaints of the was the lack of opportunity members regarding the association for participation. belief that the Association should involve It more of has been its my members in the program and the Program Committee; in the council; and in the publications. So far I have been successful only in encouraging additional participation in the committees of the Council. Perhaps, encouraging a transfer in the office of secretary after a few years will provide a model for other positions in the Association. Again, my thanks for your kind words and recommendations. Sincerely yours, Fink, Secretary Max HF:kt M.D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-2-166 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0b0012a63bbf21f2e0dd429264ba87b6.pdf 03a8d0c764d73c438541e566be99b012 PDF Text Text _, June 9, 1971 Dr. Fritz New York, New York A. Freyhsn St. Vincent's Hospital Dear Fritz, I an pleased to submit our report, ”Cyclasocine Treatment of Opiate Dependence ~ A Progress Report”, for your consideration for comprehensive Psychiatry. The opiate antagonists have been studied since 1965, and despite such clear evidence that they are safe and useful, see not used, often because some early students recall only the side effects, observed by then when they were learning and when their doses were excessive. I have proposed to the President a prophylactic agent in our troops in for more efforts at developing a long with adolescent papulstions should be It would be helpful to relates in the literature. Thank you have that cyclasocine be tried as Southeast Asia. There is need acting formulation. Trials undertaken. this report and the experience for your consideration. Sincerely yours, Max Fink. M.D. Professor of Psychiatry Mr:kt it -— W'W � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-5-319 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8d7b656d5d38679d2a7f59389dc63b1e.pdf 97fcf1ccfdd91cc772c77f19f93ac45e PDF Text Text September 13, 1971 Fritz Freyhan, Editor, M.D. Comprehensive Peychiatry 153 West 11 Street New York 10011 Dear Fritz, I am pleased to enclose a draft copy of a report of our experiences with multiple monitored convulsive therapy, Clinical Experiences with multiple Electrooonvulsive Treatments, for your consideration for Comprehensive Psychiatry. We have been able to assess the clinical efficacy and the effects on memory of unilateral electrode placements, and these studies led us to multiple treatments. We have been surprised that the clinical results of multiple treatments is not much greater than one seizure—- suggesting that the biochemical changes after one seizure are near maximal, and that some development, in time, is necessary for the full development of the changes which are the basis for clinical results. The finding is similar to the observations with antidepressant medications. I believe the report will interest our readers. my best regards. Sincerely yours, Fink, 24.1). Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-7-471 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/30953e406500be64bf1c41386c9dd4f7.pdf 9475886722f8581d8252cb385696d883 PDF Text Text 'vmm' Novenber 18, 1971 Dr. Fritz Frcyhcn St. Vincent's Hospital 153 West 11th New York. Dear New Strﬂet York 10011 Fritz; Encloeed is a revised draft of our report ”Clinical Experiences With Multiple Electroconvulsive Treatments". We have reduced the tett as suggested. Again, our thanks for your consideration. Sincerely yours, Max Fink, 24.1). Professor of Psychiatry MF:1g Enc. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-025-8-499 Date A point or period of time associated with an event in the lifecycle of the resource 1971 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/80e6fc8bb7a337d811e83364c257d34a.pdf 4d5be00a109fcb089c4c1e11b03ac386 PDF Text Text 19 March 1974 Robert Spitaar, M.D. State Psychiatric Instituto ﬂow York New York. 722 “but 168th Street New York 10032 Dcar Bob: Enclosad is a copy of the raport, "Brain Function, Verbal Bchnvior. and Psychothcrapy." for consideration for the APPA volumn. I shall try to provido a prettcu within the next cats 30: Zubin's suggastion. and V11; few days I want to take the opportunity to thank you for satting such a fine matting. If ch. rest of the Association anjoyad as much II I did. then it was not: successful. My beat regards. Sinccraly yours, Fink, MODQ Profcacor cf Psychiatry M33 MF/ci: Encl. up it � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-027-6-496 Date A point or period of time associated with an event in the lifecycle of the resource 1974 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/62f928e5493c9635c70288ccd7d598ee.pdf 935a123e5a8ceedf2831c08fe9478e26 PDF Text Text ‘ .m—v Lu: .K my.- am July 19, up. 1963 Mt: mm Clinieal Numphumcology Research Gunter William A. White Building 3:. Elizabeth Hospital WWO!) 20. D. c. Dar Fritz: I 81mm like to of C.I.N.P., including and \ \\ > - \‘:«.\ ‘ make this for the meeting m preparationsa special convocation mating on ‘of EEG puydnplnmmm either prior to or imdiamly after C.I.N.P. Mdmphmtaummdatosofﬁumcﬂngmﬂnmipn 1101: I. should be If there is a provisional pmgxm gmteful for an opportunity to review this sominim, avoid as to duplication. Inmm.1rtaddiawsodauohawnmtimwith£r.8mdleyand fomd him mat mauve in helping me organize this mam. My best mam. 31:10:me Hm: rink. Director Hfzjt' \ 1196“ ma, H. 1). : i j \ \ \x \\ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-345 Date A point or period of time associated with an event in the lifecycle of the resource undated Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/86b9d6467b84ea93b2297c0ebcf57d6b.pdf 3e406c7dc59b06604eb2e66f7d9cf014 PDF Text Text August 23. 1963 mats-51.8 mm,lA.CuN.P. mu. Clinical Memphammlogy Wm CI, Baum-ch Canter Building William A. MIME, Saint Elizabeths Hospital Hashim. Dear for Do Mu: It is with CO pleasure that I mud Dr. Sam Ger-sham mat in the Marion 0011933 of Neuropsydwpharmoology. Warship is a qmlified psychiatrist having mmivad his a». When Afmr this mm. mud W. mntly career was D.P.14. In has marked in pharmacology and during his the Pfizer Scholarship for Medical Research ~ Rom Scientist bun appointed Principal During Nissan}. Paydmiatry. of Institute the (Framing?) at shown himself he has tomonths his'tomzm of to five date, the investigator. brilliant bo an and ‘ He has mtic I heartily WM ‘ him for Whip. 31110321137 W m Fink. I yours, M. D. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-397 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/86d9c66ce8546ef3c0a392b29ed776a5.pdf 63867fe5e15c3554b8fa26f22b23ac69 PDF Text Text August 25. 1963 mm Wm, A.C.N.P. Clinical Neumpimmcolcy Research Center I». Fritz A. CI. William A. minim, HID-ﬂ, \ Crodnntiels mite Building sum; Elisabetta Hospital mm. Fritz: Do Co Dew Whip in the It is a. pleasure to monument Er. 'l’uran Itil for Mariana College of Hempsychopharmcology. Dr. Itil is e mater of the Collegian Internationale Memo-MWogim and Arbiteminwhnft for Nemmydxoprmkclcgie. For the past ten years he has been working with meesocr Flugcl in Erlmgen. Rio contributions concerning psychopharmcolow and the EEG changes in peychmtric patients are well known to you. In March, I». Itil joined my staff on leave from the University of Erlangen. He has been appointed Principal Research Scientist (EEG) to the msacxmi Institute of Psychiatry. Imuldbopluecdifhemacccmcdfclmhipinmmﬂm sincerely 3mm, m3 Fink, Erector Me Do � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-017-6-401 Date A point or period of time associated with an event in the lifecycle of the resource 1963 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence