45 100 6561 http://exhibits.library.stonybrook.edu/mfp/files/original/ca687a22612e6a27edf573dfa7b36fe4.pdf 491852bb915f0aada029ee8e8bcd7a65 PDF Text Text May m. A. J. Associate Squibb Nu 23, 1966 Sammignc Meal mum Institute hr Medical Research Wok. New Jersey Boar Alain, Idid mamiwmmmtofmmappoimmnt at the New York Medical College. The letter when was waiting far In I arrived last Wacky. at Squibb, but I did so Latin this opportmitytomngntulamyoumdtoMpe that your nw positicn will provide you with the opportmity you takes Sinaamly yours, 'L—w-vﬁrmww;‘wavwvn‘yv'mwr.¢wn7lw'a'w‘w'm ..-_A -‘.x —w *»'r’H—n-‘xﬂ'ﬂr'r~.-' ﬂax Pink, M.D. Professor of Paymiatry ﬁnkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Sanseigne, A. J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-303 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a9fc124638d6b86c537ed07677015b16.pdf d50d95ae8e05c6d1bc0a574f64af33f4 PDF Text Text May Dr. 102 ﬂounder M. helical 23, 1966 Don Towers Jeppe Street Jaimesburg. scum Africa Deaeryn' I mfmmmaddmeeﬂnatymhavemkenmmt minim seem to be an. mice situation. 130k. and good are at mm“ welm‘tim of eyelmnine this it of WW reported. ﬂmmim denature mumbeingmlewmmmnbemimminm here The completed an high speed. going and 311116108 and We have ram being In addition, undertaken a m analysis W. that I leaving, W1. mm.W,Alimddewnwillbeabletemlete IhOpethat early of 312-155 and these males we have New am (ha-1m the next half year. I amiaaving for New Your}: and «new in mid—June,SﬁnAveme mmsmmmmmymmmmm. York. at 106th Street. ank. 10029. New ms Wis the established for me Mew any relationshiys mid: have already been the appointment as Clinieal Dimter far themntalﬂealthmn‘ter. 'Ihiawillenablememdewlopduniaal redeem-n pregnant in the 100 bed own-Patina: Bazaar-tum. institution as Ofmvwimsdmgemich have well an in the been studied, ﬁniuthim mwbeﬂnemtpatmtefﬁnemwpeydmpicdwm fluphenazina dewmte whim is a lung acting a wanderful additimal tool in the schizophrenies. trumnt Wham, Main of Hermvebeweblemdismseanunberof thammﬂﬁsmmmmmmmtmoemwbemh 'miwtmmwngﬂmmtotakeﬁmirmdicatimmmirm. One of the me {Damned is in mm addiction and w wehawnwbemmstwieeefammmticenmimcalled cyclemcim. Me Me been of great interest mnd I have unwted, because of its mmuphysiologieel wafﬂe. that it be tried as an *7 antidepmseant. �La». -2.- A. Dan May 23. 1965 matings, mam your qmstiona meaning the amt aimeIluwnotbeanattendingmmrthapastyearanddomt I ECDEU plantodoaointhefutm. Pamapsmtimewithinthemxtyw, we will apply to Mama an offiaial ECDE Unit and may at that time begin to attend these matings min. The girls have mntimed their intmst in dancing and we mploasedtobeablamtakaﬂmtonYorkwhemmthink their training might ha maimed. Martha joins me in sending you and Batty ear best regards. Sincamly yours . ' Mf‘zjwh m M, Nd). I’m-femur of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Don, Alexander M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-302 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8adfad8fe0611e05802ec89714b84840.pdf 65ef262f8c5664ea654fd3d3fbf4ad11 PDF Text Text May 23. 1966 Hem C. Dunbar Strut Wards Dr. State Hospital Matty: 600 E. 125th New Inland York, New York 10035 Dearﬂy, Aslhawdismood,lmuldbem’cgmtefulformopportmity tomymmfwiutyformmoomingofmmsomtlom oontinmapmlinﬂm mlyais bogminﬂisaouri. ‘Ihepzojootis a mmophysiologioal evaluation of oyclmoim, a now narcotic antagonist. Ihavoalmadymmaoutctrialsinoohiwphmio pationtsmdwouldmwlikoto-‘mkomminamoftm addicts at of the Hospital. A is attached. W. mum mom». Dimudm've W protocol copy both givon their appmval. Forewofﬁnpatientsmalnadyhmaﬁtypemissim for the administration of oyolmomo and copies of those can be made availablotoyouifyouwish. Ihavo ”mm. Solvartzm sendto of your responsibility -» for we will aooopt you a blowout full mapomib -ty for-tho smdioa in your laboratory, as well as the to and ﬂux: mttopolitm Ibspital. As I have Minted. we will ask one of your tool‘nicims to assist us in that records . we will memento her at an hourly mm to be set by you. Win: ml Ilodcfozwardtoﬁxisstudyehdlammot gutoful fortho which possibility you an affording on during this maiden. Sinoomly yours , Max Fink, H.123. meossor of Psychiatry MF:kp oc: Dr. Freedman Dr. Sharoff Mr. Wm � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Denber, Herman C. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-301 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4b7e2e7f0d71bcfa0d38d037fdba5006.pdf fd5fb03587c3d6fd5d187b4f78fb14f7 PDF Text Text May 23 , 1965 Ex. Louise Timon Emwtiva Semtaxy Child mm and Him Wt rhtional Bastims of Health Beﬂwsda, Dear Dr. Mylwd Prom 2001“ 13mm: It was kind of you to sand me the Project Site Visit Report for the We University Rem: Application. I fomd t] mpm’t to reflect my own thimdns very well and I believe the were eminently fair both for the scientists inmlved and for the midis 16: NIH ‘— —. v v .w -— . program . Thank you for the maturity of reading this report. Stately yams, — w « — v .—.—._«»-,,wr—W-WWmn,mu~.-—W«m.mnmw,-.~ aw ﬁwru "7‘ a-r-nrw u-vmuw-u-n you-.— Max Fiﬁ-c, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Thomson, Louise Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-300 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7d0a443394176430f54a69f23e196591.pdf 0319d75d7472c0b80fd60a67f569cc05 PDF Text Text May I». «33 23, 1966 mm leW mmm {no Boston 15, Street marine, I ta haw you Chair the msien inAtlantic Cay. It was aplmm difficulty. that I did not give yen mt 1mm: Ywdmmmvimmofmdmmmalityasm"m in a minimum demiztim. the want}; W m” Iamloainga~* miehmvmiehmsmimmofow Imalmtaking ﬁxing mummmmfmmaneimd. ﬁmﬁbertyofsandingyouamwofthewmutypapsmm BobKahnmIWMImatmmidu. Immimod. mmummmmm‘nﬂnmmmam, WEB an as inmortant in writ: am W mmmwmxmnmmxmmmmm mica'tzgstmaumhtowly. mummvalwu the for mmdsive in that the pemmality «2: {mm}: as thc mophyshhﬁcal mama to mvulsivn disappointed that my ﬂaw people chmgaa Wives. I M mmmnsum manual etudiea.andwdieappoinmnt is the infomtim rm Wraps: pmmsa, mad, ample, litthstudydanbyBMﬂymmmmnmmﬂngm-nm Mmit. Hybestngam. 3321103:me 31m, ﬂax Fink, Ed). Profaswr of Psychiatry ﬂaw � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Alexander, Leo Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-299 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/cbe9bf8ea44a2d734c9850feb82fa7bc.pdf 532cc402283c32036adf0c57b7d33a2f PDF Text Text 1-wvn- May W Mom Holt Albany. York Dr». 23. 1966 of Psychiam Now M8111. IWWMwatMWWﬁaqmdmsmch mqulam ymmiudinmmmntkmﬁcﬁty. mmlwﬁjobinmhtingwmmmﬂummlhiatmyof studies, meadow remand Walt new Iwmmﬁlmabhm Madman. on the your mﬂmmmll,MIfeltﬁmtﬁmWﬂutm mmMYMmmoiwfﬁciemdcpthmmvidemW mmwmtywummﬂmtmymmiw Mlhndtimtommr. Wsmmtsmuking Perhaps itwinbepmsiblotowmmmﬁcrsmdiesmceagam‘ fwsmlyithmimmtﬁmﬁammmty. Again-L. 21y distim. Simmly ma, thwks for your kind W HM PM, Man. of madam � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Holt, William Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-298 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/407eed1743443b13fccb74a8164fd7ef.pdf 102729b2fd71e38ebc2f49205447a52e PDF Text Text .w -.- vw.vw..-,.—..w-n——. www-m"v... w ”UMP...L ‘ . -. -- ~_...,-;W~ w- www' w—rww"-mw W W, W m. Nathan ,— - r— ,,.—vv.~mm-» ~ —. -— v—\ ,, w m ‘Irwrw 5. Kline State I‘kmpital New Yam “a“. Whamofﬁnmmwhichihawmﬁmly to for the muting in mm hie 8am fm'trxxmﬁng Madrid. In latter to me. he indicated that the full paper should be approximately twenty minutes in langth am! we will abide with Inhouldtuwthofullmxtavailablabymond agatgzidalixu. 0 June. My best mm. Simly yours. m M, 11.1). Mum of Wintry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Kline, Nathan S. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-296 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/26a6015d56196838c90b488bfee97ad9.pdf 977a5065aab45a99122ef994e9bf05d8 PDF Text Text May 23, 1966 Dr. Willim 2mg Howital humRom Wimm Carolina uni-mm, ‘Dear Dr. 2mg: Itmaphnmtalkingtoyminhtlmticcuy. Iwuld Mmmewmmmamofyowmmmlmvim haw axis mvimd at tho radical Schoel. so that I I mt am moms copies of the pmtatim in Atlmtic City anmllasthe when pmpmbym'. Stupimmdnyself. The prom an included and I mum be pleased 1:0 discuss this with you be av at your plmm. I dimmed wiﬁu taful few any Dr. Siupim the l‘arkavim Model and I would of yeur reprints and proprints whim may he: lcsoﬂmtmmlommahwtmapplioatima. I was also 91:1de to review the effects of various meleepmdwmﬂnbeplmdmmampyofymmpmsentaﬁm inAtlmtic Citywmnasthewliermetoﬁﬂchyoumfamd. We My best mm . Sixmmly yams, HEX Fink, Mum HOD. of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Zung, William Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-295 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/11e3dbbcdf99c8a886dddc864f1f76d0.pdf 9d753230700d8849ea12efa996919430 PDF Text Text w v.7 W-" vwm'vv ~wnm—m. ~~vw—.m. -.....w.-—-——w , v,- .—- Tm w-wwwr-mr. . "ﬁvuwu -r“v' w- me .wwvmwnm‘wvmmtwlv anw May 23 , 1966 l E ! m". Bane Haitian]. Wm of 1mm: mum Mylar-ad Baﬁmda, 2301i: www.mz ' W.Eumm$kaofmnemmracilityattmmlmd Stateﬂospitalwaakindmgztosuggaatthatxamdymampy ofmemlosadpmpﬁnt. I have: put this mminl togeﬁmr to provide with a (ﬁends interested many mm den give a which am publimlly available. A of tho appﬂuatims of those studies dafinitiw in mm being writtan and will be submitted for publicatim. Wt Mﬂerimaofmutmhmmmmmmmmm the Dr. Shapim mid m W Sinonm'ly yours , H.13m m, meeaanr bf Psychiatry .— W-w‘ vW,..r � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Waxman, Bruce Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-294 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/496a8e2b6acb400026b3611e647eee27.pdf ec915c1e79a49442fc11956f787a29d7 PDF Text Text .. y—“w m yaw—«Kwrvy‘m‘l’m' . mm V. ..V.. ..n—-v,.m. .v»w_-_..-. —.—....‘,r,j._ __, ~ ,_...-. . V. , , Him—“m- -. WWW“. "my m. WWW—v. _,V,,,_ My 23, 1936 W mimity W. K. of main: Mains, Sammy Dear Dr. Heixmich: Iwiahmmwuforymmkindimitmmtoattmdm As you W, ﬁlms unable to Swimm Pschmpnhology atmhutlmmtcful forymrmmmmesa. Have almmmiwdymrmyrmimmmwlmof deal of interest earlier promedings. I have mad this with a mat Itil fwhﬁngﬁngtorsyatmim mdlmtﬂmkbomymmw. a ”Mass of atmiies which, I believe, will make a major contributim to our Wading of tho ammonia promos. Ilodcfmmsoeingminﬁmm,w£fmopportmity mmxtsimlffmymtomtotmmmsmagdn,l wouldbeplamdhahwymviaitminmymlmatimim NewYommdicalmmgo. SW15! mm, Pink, Md). m Professor of Psymiatxy ‘m ., � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Heinrich, K. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-293 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/422fa0ac7292ae95cc2113021f36d9b0.pdf df974eba6b4a61fb6b1dcc3ab7892886 PDF Text Text May 13, 1966 Dr. F. M. Wagenoder Surgical Clinic- Univemity of W, Austria W Dear Dr. Wagenedar: tell Ir. me Molar-dam of mthing St. Louis {River-airy was kind among) Woman. ofthopmgnmavailabla, and I amwritingto ask ifacopy Euchre-amnesia . to of the forthcoming Intematimal smegma: he did not haw a copy on and aﬂm information for inmmsted mm be available to . participants wad of the preliminary made ma 'lhmk you for yam" cooperation. Sincerely yours, Max MP: ﬁlm M, M.D. meassor of Psydxiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Wageneder, F. M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-292 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c70dd5c389bcede0809f39a549c06f5f.pdf e67747a74fe55b599abdaf9621d6a10c PDF Text Text May 10, 1%5 Dr. H. Vojmdaovsky .mmmtory for Experimental Paycropaﬁzology metitute of matrimony of Public Health Caroline university Prague, Cmctmlovakia Suhool mm: Itwasayeat pleasm havingyouvisit usinSt. Louisand ItwpaymaajoyedyamvisitasMaswanjoyedhavingyou. IWﬁmtywviaitadeYcrklaatwaekandImgmtverymch thatluasmtthem. IhaveheencwingmNewYor-kforafaw dayaeadmmekmdlammyaettingupwmlabmtories. Dr. Simeonhasgme madmdhaswrittana fine manuscript descrdbmgcwexpericnaeawithd-cyeloeerm. Asscmaswehave areaamablygoodcopy,wawillaendonetoyou. Thankwawrymchforﬁml—eycloserim Dr. weenie andIhave just inmmstedingivingthismaomofowpatienta 200 In he the wartime, into for to capsules. put it m Wged Ihmcmrtaetedﬁremwmugminimimandﬁmytellm thatﬁsamafawfactatkmtwillbeneadedhefommcmmceioe in patients. Specifically, official pamiaaim to um ﬁns ﬁxeywouldlikemhmthemufaettmingmes, the controls for writ; or stmdazdizatim, and any infmtim regarding stability. Inmﬁmtthisisaekmgverym, butifauchinfcmetimis available (and it would be just as acceptable in Cmcroslwaldan as in English), it mad melee possible the legal achninistmtim of L—cycloeerina. If this Maturation is not available and there is describing your authsmiaatim for the use of my official Lacycloserine in patients, perhaps a copy of such authorization may beuseful. Alammopmdmadﬁxis Waforyou, andis it W Wt being used new in oﬁnar studies and by winch investigators in which laboratories? mt You mdemtand that ow Food and Rug Administratim is probably closely approaching the high stmdaxos set by the Eastern in me control of science, and my help you can give obtain permission will he appmeiated. to w mm �I Dr. Vojtedmsky _ ~2— May ' 10, 1966 Dr.81memmllsmt%mthewilljoinbothDI-.Itilanduyself iandemmtmwinhawmoppwumitytoviait mmrmo ~21mvierhaswdmpublishampmmdingaasavolmin W fmmuawdthinmmfowm. ”cam; Lu m EumchuﬂyouwnlbaMMngnm-edeﬂnimly mt W4» Stanly m3, ﬂax Fink. 94.9. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Vojtechovsky, M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-291 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/54b663f21bd3fe2d3364a4c5abb31338.pdf 7150b8aca97b01aa20efa33b73782f58 PDF Text Text May 17, 1966 B. Toma Wee International Research Prom Section Mew-oh Grants Emmoh National Institute of Mel Health Eethesda, Miami 2001“ Dear the. Re: Hi 12973-01 TM: I have read the mimetic») for a travel grant to the Symposium: on Bleetmsleepthempy and International ﬁrst male with a mat deal of interest and I am grateful for the opportmity to have reviewed this problem. While I believe that the problem an and the methods are of simifiomt interest, I am humbled by the abaema of any paydaiatrdo interest om participation either in the meant symposimn in St. Mamie or in the proposed list of pantieipmta. Speaking oandidly, 11" cm owld he wound that at least two qualified American psychiatrists with clinical . , mew , daemon either mavelaiwe therapy or this applieatlm should he mmmnded for support. The list of invited epeskere for Buoys domain no names that are reﬁner to me as psychiatrists or Wysiologists. believe Precisely for this mason, and beoause the that the tedmique induces behavioral oranges, the presence of payohiatrists mule make mmne the expenditure qualified of the additimal funds to allow other American myelologiste and animal mtkere to attend. eaqaerienee with were to attmd, Write Ihadoalledyoulaetweektoobtainmedditioml reports from Do. Short, but was fortunate in obtaining moh oftlmmededlnforeetimfrmbr. Alfdeichardaonofthe Department of Physiolow of St. mule deversity. Based on the inﬂammation in the applicatim, and the letters submitted, I would like to specifically yaw request within the guidelines dated August, 1965. I believe that theme is scientific need for this omfomnoe, and since the greatest lntamdt has been sham by European organizations. the intemetioml meeting mm �mine B. Toma . -2- May appmpriate plane for our suimtim to obtain The mowing agency a fruitful dome of may be an one. althmgh, the Society of Biological ta Psychiatry, were their immatad, might be more Then 5.3 no mama of the utting. the midget. or the: ﬂamed prom. The primipal criticism is with regard to the mlevm of this wins to the Hatiaml Institute Of mm]. Health and t0- a minim far mpartim the Insults to Mariam psychiatry. “mace two mquirwmta am lacking. For would be an " Ware. Wanton. Wm thiammn. Iwouldmmmdthat this wtbeaypmvedwith mm funds only if M qualified psychiatrists mm manta}. know to attmd the mating and warn willing to their obmaticm mum am has to" the. paymiatric Wty. mmimte this; If met, I mum minim a priority of W W m. additioml Mama I would diaries m.Liberaon 3mm“. Manner of Twp!» Uhivnmity. cf the Vatem ministration mtg-i in Hines. Illinois and minim mm. Profuse: of Psychiatry at the Album! Medical Beluga. As tamiew. mmwummhfwmowomﬂﬁty ~ this mitigation. ' . Simiy m. PM; N memm of Psychiatry Mon- Mszmh 17, 1956 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Torres, Lorraine B. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-290 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e751042822540bf3ea34c84ba50df2c2.pdf 29cdb0bd4141e01256169be23e5f3cba PDF Text Text May 16, 1966 Dr. Jamthm 0. Cole Maximal Dam building 8917 Arlington Road Bethesda, Dear mm Jmﬁma I enjoyed our mating in Atlantic City. m suchmats, I thwght it be helpful Following yum would is ask We to Wider his positicm the transfer of the equipment which was broughtnew from 1 hope that I can nominee him that Hillside this is a wiﬁmut having so ask to with Mini. any m minis We official Wiestion. andadvioeinﬂw Myanformmistm Whydmhmoology-Omtar study proposed My WOW. best regards. Sincerely mm, m). meessar of Psychiatry Hex Hrzjsh ms, � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-289 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7ce4d7ae6dfc8c346c3690e8eb6caa3e.pdf d95b7a05391d0b2f12d67b44ccaab4b6 PDF Text Text Phy 10, 1966 Mr. 10! Stmlny Gold Gummy Emmi 8. Kenny 2503 m Clayton, Missouri 63105 Dam? Mr. Gold: wouldywkindlypmsaasupplyofl-cyclomrmmﬁch inmmsulnaafzoomeach. mmdnlivwingtoym,200m, Iwould unsiuofwnulewm in forties or fifties. appmciam these being bottledWym.3. willomﬂmacamtprimof $50.00. This Wyaplmbiumdimatlymmmwﬂlbe 3W5: yams, paidhymmimityofuissmri. Max Fink, MD. Professor 0f Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Gold, Stanley Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-287 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/35cb343dda8645fa46b6917d8ee73631.pdf ccceab95e31cd20e6b05cce160fb71e1 PDF Text Text May m Ms W. 10. 1966 mmr Cu Manhattan State Hospital Island 600 E. 125th street 7 Ned York, New York 10035 Dear ﬂy: The data analysis of your firm: study is owning very It was first Weary to ﬁ'zack seen of the records Wmmwsesaawenaeselectmofmmtmmm for the study am one had been collected. 0n mmelyais who of the well. in the WW“: position. form We no variable again showed diffmm mg the one groups. item with . this we analysis. equal analysis. fordatemintngthe the thm drug omditims. We will be rm beam the tumpmm mg off axiom}: undue shmldhavo the data available within ten days. mdhaswittm differences Dan has; Wehawpleyodbeekmofymmmtmmﬂmlymd mofthemom. Withﬁmsapwnmpmmdbetwm we have no difficulty in identifying end-n As you also provide no difficulty. mic, ma form's etudywemuld preferaminimef times and 1mmm, saw)», and the analysis four-five pretreatment recordings. I are returning m tape and our: playback with the suagestim that you told both until a (incision is necked as to which fauility may be able to accomplish the mlysia. ’ minim I have defeated wiring up the behaviaml materiel until w have completed the EEG analyses, and will dismiss these with you within the next few weeks. that been Wing to New York weekly and believo will astebliah a water mlytic facility at tho I rave we College. plmd If I don't see to attend the you Em in New ms: before then, I have I will Meeting on June 2-3. �Dr. Berber ~2~ probably take the: 7:00 p.m.-8:00 p.23. air shuttle from May 10, 1966 New York onWedusdayavuﬁng. IwillcallyoumWadmsday, June 1, to see In: you am getting to Washington. My best regards. Sinoemly ycmm , Max lizjm Pink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Denber, Herman C. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-286 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/955a9fc43421a5db1996afc62f6a3f5b.pdf 4d108982c6b4797c15fa7e217783cc8e PDF Text Text May m». J. Robert 10, 1965 Wm Assistant Dimamr Clinical mwaﬁgaﬁm McNeil Laboratories, Inc. Cm Hill Port Road Warm, Pemmylvmia Dear Dr. 33mm: Ebnmixgyourlemr,wehavechecmdmmfileaamifind 1:13:9an suppliesmbeingmtmd under sepamte cover. tablets tablets/bottle 12 bottles 12 bottles «lmg/ml—mmlhort‘tles 82 2» -— 5 mg We - 2.5 ~ so 13/1111 A Was - 1 mglml mm): you my mm for WW Wﬁm. ﬁinoemly 1m, Fink, m Professor of Psychiatry MOD. 1'?sz � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Hewson, J. Robert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-285 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6f6db19c8504139a618097389dfeea55.pdf a47cba753ca89f40eddb0623ba2e8d18 PDF Text Text 10, 1966 May To wl'm it my cmcm: Miss mmmmappointsdtoﬂxe Wtsrf‘acility' at the Missouri Institute of Psychiatry in February 19614, as - analyst. In Jmusty 1965 , when the Institute boom of the mimity of Missouri School of Medicine, a facility Miss was appointed as msesmh sssistmt. ms Conputsr Facility of the Hismi Institute of Psychiatry is an affiliate of the Bustlingm thivsrsity center. prom Him War Him this pardod, Miss has been mapmsibls for- data machine processing, opustim, ms the integutim of this unit with tie larger miss at Washington Faring the period from Psbmry 196%, to Gotcbsr 1, 1885, she was directly msponsibls to m. Since October 1, 1965, she has been directly responsible to thsDixscborofthis facility, Dr. Slupiro. Shehssbsen an inﬂow part of study mar my supervision, During mimity. am WM. prom includingsuchspeoislsspectesstm qumtificstimofmslogﬁﬁe signls and the library study prom for information mtriexrsl. thhispeﬁodlhawfmmdﬁissﬁicmmtdﬂigwt, cooperative and pleasant. She has assume! responsibility and smarcised this with test. discutim. and has dewloped the facility to this W signals, ssitdossofmmﬁlnowithnmm the handling of specialimddsvicss for inclwing tape recorders. She is sssocistss and I have always fomd it a pleasure malog wallmcsd by herto work with her. smallest judmt. She installstim, consisting Amjorpsrtofm promwithwhich I luvs been identified will he terminating at this Institution in the Fall of 1966, as I an relocating in New York. Miss Minimum for the duties and services for I would which she is capable wiﬂmt mamstion and mid her as an excellent W ma War. Sincerely yams , Max Pink, 3.1). Professor of Psychiatry �May 9, 1966 Towhanitnnyooammz W Camtmaeﬂiolonmwaseppaintsdtoﬁrewterf‘ecility Institute of Paydﬁﬁzy-in Jme 196“, as pmgmmnr at the the Institute beam at facility of analyst. In January 1965, Iﬁssommi School of Hadinim, Miss mm was the miwmity of Miss m appointed as research assistant. of Psydﬁstzy mm Institute War 0mmof the Washington University Center. affiliate this wind, Miss Him has been mpmsible for date pmosesing. mm operation, and tho integratim of this unit with the larger neuter at Washington adversity. Mag this time, she has been directly tumble to the Disaster of this facility, is Facility of the The W an Br. Dmaldh. Slupim. mustaenmintemlpertafnmnmus study w supervision, including such main). aspects m infamtim mtricvel. pram asﬂaequmtifiaatimafmelagmsignelsendmelibrmsm prom for W this period I haw rm Miss Him moot diligent, and plaaeent. ﬂan has assume! responsibility and «months examined this with tact. dimtim, and smellem: judgxsnt. She has developed the fanility ta this inetellstim, consisting as it does of m IE4 1710 with nummxe specialised devices for the handling of analog signals, including tape recorders. She“ is W mllliksdbymessaaiateemdlheveelweys fmmditapleem work to with her. part of the program with which I have been identified e1: ﬁxis Imtitutim in the Fall of 1966. as I muting New York. am mloasting in A amnion will he Imuldmmodtﬂssﬁickmnforﬂndutiesmdoewiaesfor mahsMieaepablewithnutmeervetimmdwwldmmdheresm exasllentao—warker. ' Sincerely. yours , Max Fink, 24.1). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: To Whom It May Concern Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-284 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/01da6ab29cc3cdd3b466c4d8edfc76f4.pdf 009104cc709a512146055a0f29fc24ac PDF Text Text ‘ 3 é ; E May mom (311M Health and mm Natimal 1):». Wise Emmtiw Sammy W of ibalth Instm 2003A Bethesda, mar Br. ijm Timon: 23, 1966 New ItwmmofywmmeﬂumjmtSiteViaitW Duke University Applimtiw. I fomd the mom: fer tin Ram mmﬂactmymmtmzkingwwmnmdlbamwmmmm were mainently fair both for ﬁm adenﬂsm inmlwd and for the NIH program. Wmfmmwmityofmmngmismpm. Simumly yams, M FM. 14.9. Profesm of kap many � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Thomson, Louise Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-283 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6f318e056f9e3bbeb4166cacaf6709a1.pdf e378cc3ec6e5e3f26762b7f9b55027b1 PDF Text Text '7 77% m" ‘- rgl-‘PI’VU.- ‘9" "9w v.‘ 'r. WWW Mny mm. P. )4. 18, 1%6 WW Clinic Udvhmity of 1m: Mattie: m, Wm m. Rickardsm of Dinar Dr. Wmitymkindemugsto unmmﬂﬂngefﬂmfomhoaunglmemﬂmlWimm 81:. Louis mmmmtely,tndidmthmampy Emu. ofﬂwpmgmwailable,m1mwriﬁngmaskifaoopy ofthapmlimmarypmmmdaﬁm'infmtimforinmmud pmicipmtamuldbemmilablamm. M you for your Winn. 31:303me yam, Hm: M”: 3m Fink. MJ). meosm of Psyd‘miatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Wageneder, F. M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-282 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/71043fb37c9683e020612ccf39590e15.pdf be3a420274695ec20266bdb57eb64772 PDF Text Text / .qw May 17, 1966 mm B. Toms Intemtimml Research Programs Sectien Reward} Grants Branch National Institute of Manta]. Health Bethesda, Dear Hrs. mm 2001“ Re: m 12973-431 Tm: I have read the applicatim for a travel grant to the First International Swim can Blemleepthamw and Electthamia with a great deal of interest and I am mteful for the opportmity ta have reﬁned this problem. While I believe that the pmhlem described and the methods are of swiﬁcam intemat, I am mauled by the absence of any paydxiatric interest or partiaipation either in the recent in St. Louis or in the proposed list of participmte. swim Speaking candidly, if one could be assured that at least two qualified Mariam research psychiatrists with clinie‘al experience with either Waive therapy or were to attend. this applicatim should be mmmd for support. The list of invited speakers far Exampe contain no names that are familiar to me as psychiatrists or murmhyaiologists. believePrecisely for this ram, and. because the that the tectmique indum behavioral changes, the presence 91’ qualified psychiatrists would make wwﬂnmile the expenditure of the additimal funds to allow other American physiologists and animal markers to attend. I had called you last week to obtain sane additioml reports from In“. Short, but was fortunate in obtaining web enamels mute Alfred RichaMam of the infmtim from Dr. Louis of of St. Physiclogy Uniwmity. Based on Depéutmt infommatim and the letters admitted, in the the applicatim. would like I to specifically anmr your request within the dated August, 1965. guidelines I believe that there is scientific med for thin conference, and since the greatest has been 31m by European ommdzatima. the inter-rational meeting of the needed mm �Lorraine 3. Torres would be an «2-- my 17, , appropriate pleoe for our scientists to obtain fruitful degree of Mention. The spomoringegmy may be an appropriate an, elthwgh. the Society of Biological Psycmiatry, were their when intmsted, might be were a appropriate. more is no oritioimn of the setting. the budget, or the plomed program. The principal oritioiem ie with regard to the mlevazm of this meeting to the Maximum Institute of 231so Health and to a provision for reporting the resultato American psychiatry. The“ two mquimte are looking. For this mom. I wild that this wont be approved with funds two rental health only if qualified payohiotriete were kmam to attend the noting and were willing to mmnioote their to the paydziotrio monity. If thio be audition om met, I would assign a priority of on. me! Wetim additional referees I would Professor of Temple Wmiw, W,meeeew Minimtion Facility in of at As Vetemns Holt. Psychiatry ‘ a More Illinois and Willim Hines, the we 13m. Charles Libereom of the Albany Meal College. Wyoumymhfmﬂwopwmmwtomim this opplioetion. Sinoemly yams, M7 mil Fink. E. Di meeeeor of Psychiatry 1966 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Torrex, Lorraine B. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-281 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3bf9143996d316b3eb5b714a917445da.pdf f419da1333f72825e6b27c730aa3b0eb PDF Text Text May 9, .1966 Wmm Effie” Macadam Mm Metric Susanne thm Mr. Public 1700 '1... Robinem Washington. 3.639908 . NM. Effective June 1, I will be! at: Fink, Md). Profmor of Psychiatry Max Meal college New York New York, Fifth AW at 196th Street New York 10029 I muld mmst thet mmicetim after that date he gem: ‘Sizmmly yams , Max Pirﬁc, H.219. owem of Psydxiatry Wzkp time. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Robinson, Robert L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-280 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b28a75e38699477aaa2634c7b751ee0c.pdf 68e63be4587d0e65eed13e2aea9caf06 PDF Text Text May 9, 1956 om.mmomsm WSW! www.mm r mum: Immitmgﬁdslntmof' Ihavs m.mmnmm,mm:.mms mmmmmaummszmrmssMsmtmt inpsydzimyettmriillsidoﬂospitel. .. . an. mm pertinipetedina Folemid-wymining inferon dining ﬁn“period 1951;»58 Psyohinuy m m Whilst Ministeimdnpsismpmtiosofmmopsynﬁm. Sines issawrmnmmmwrmmmofmm imninolinionlsanction. At mimmmpnyansmmmpmtim. antimihnvefomdhimtsbssmntsimonn,ﬂm Inhisianm www.mfamdhisolinioujudmtmhe mihntmdmmtplnesedﬂmthsmehlstomute - emofstudiss,mofminummimtadinsspeoislm mmmim. Invehudmdtmtyssdismsmssssloadwith himmmmmmimsmfomdhisdescriptimsm Within: Wmmmwmmm. Whlﬁﬁaxmfemdemofwmtm mtﬂlyintshiswnnnimmtmﬁﬁedhyﬂnir Wm. Iwwmmommdmm mtmmmmmmmmmmmmpam withentlmissmmdintmst. ImuldliketsaddthetIheve mmmmnmmmsmmmmmmmly Wadmmstmtiﬂsdmnmmpnmmof Wmestablished. Immmmmmso pInning. Ibsliowkukeplmommduinmssimificsnt mtrihxtimtothsmspim'epmgmn 8W3; wars, Hex Pink. NJ). Professor of Psychiatry co: Dr. A. Kaplan � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: North Shore Hospital, Credentials Committee Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-279 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b00b27992e54c20c30dd1b2152b7a1ff.pdf 649d34bbec28c6f2f0a5579a55962fdb PDF Text Text �HP. mu W 7. ~2- 1968 Mmmmmmmmhmmmw mm‘zmtmuinbowhwnmﬁmto Warm. m ﬁnk. a! mm mum 21.1). mu: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Burrell, Craig D. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-278 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a4ab180e0dd50f3ff7771786321d54bb.pdf 059595d6f16cf348bc3721d4ab1451c9 PDF Text Text Dr. Jonathan 0. Cole Netioml Bank Building 6917 Arlington Road Bethesda, Maryland Deer Jonathan faded with e amber of technical and administrative with regard to the preparation of a grant application questions New York Hedieel Galley for the Ice—establishment and free the I am malytio program for "BBQ and Human PsychoRetherﬂmepmdﬁmtimonﬂretelepmor in letter. I believe we both will be in Atlantic City for the meetingamxtwasm Implaminatemive Tueedeyeftenmn and Thursday. Except for my and will be available 2:08 preheateﬁm on “muredey at pm... I can set aside any tine development of an Wiley." may on the rant of the schedule. that I we assist would be Wain). if you would indicate a My m in the privacy of yew to in the preparation of this project application. might get together me half—hour twat Sincerely yom‘e, m Fink, Professor of Psychiatry 24.13. ﬁxjmh �~2- Dr. Human Effective June 1, my May 7, address will be: Fink, NJ). Professor of Paychiatry Max York helical (bllege Avenue at 106th Street New York, New York 10029 New Fifth Again. many thanks for your cooperatim. Sinonmly yam . M, w; ﬂax Fink, Md). Profassor of Psychiatry ‘vv:'mvi“v.<“'7- —r .7 “ l‘ﬂﬂ—n-wnm’.v~r;y~ 'wu-maw Hfzkp 1966 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Hewson, J. Robert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-277 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1f2793e62fb4328296c40f7a1a6b4b34.pdf ae3a212a11d55f5e5e1db9578be0603f PDF Text Text Dr. Jonathan 0. Cole Netioml Bank Building 6917 Arlington Road Bethesda, Maryland Deer Jonathan faded with e amber of technical and administrative with regard to the preparation of a grant application questions New York Hedieel Galley for the Ice—establishment and free the I am malytio program for "BBQ and Human PsychoRetherﬂmepmdﬁmtimonﬂretelepmor in letter. I believe we both will be in Atlantic City for the meetingamxtwasm Implaminatemive Tueedeyeftenmn and Thursday. Except for my and will be available 2:08 preheateﬁm on “muredey at pm... I can set aside any tine development of an Wiley." may on the rant of the schedule. that I we assist would be Wain). if you would indicate a My m in the privacy of yew to in the preparation of this project application. might get together me half—hour twat Sincerely yom‘e, m Fink, Professor of Psychiatry 24.13. ﬁxjmh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-275 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6e01212d8bc5acd0339a72c368ac3c86.pdf 031e02d80cf3cf3eaa8dbeb914b88ded PDF Text Text Hay Rabat-t C. I’m. 2, 1966 Mien M1031 Liaise!) Staff Clinical Investigatim Departmnt Smith, Kline and Prune}! Labozutcxies 1500 Spring Garden Smut miladelphia, Pemwylvania 19101 DearBob: Islwuldliketobringymwtodatemﬂmsxfstudy doses of ambarbital dummtias of different www.mdaumlleoﬁmpmse hasheminpmmsstormﬁmﬁvemnﬁm. Asofthia MWW. dam,twsubjwcsmmwmlm,mdﬂmmmmadditimal of clean six response subject-"a who are in process. muse subjects mquire butinaofaras unrequited four, mm, itwilltakefowmlcstobemleta,anditismyexpectation Mlve additional mtanﬂndatawillbeoollectodbytmmofﬂay. Data analyses will begin prowtly and it is cur expactatim mtmwillbeablemcouplmtheamlysea dam-ingthesmmr, harming any WOW statistical or analytic problem. 9.9wa, Iwillbemvingtotmﬁew‘fokadical Despite this transfer, It is College early in June. my intentimtoompletethissxfsmdymdmdoso, mydata analyses that am not couplemd here will be mlated in Maw York. I will wally mp1: thethisresponsibility for write—Mp and the natavial. the pmsentation of WaddmsainNmYozkwillbe: Dapartmnt of Psydﬁauy York Bhdieal College 5th Avanm md 106th Street New New York, New York 10029 I will also be spending part of my time at the Mempolitan Heapital. Ifyouwishtomachmdm‘ingthenextfewnmﬂw, muismdmysem'tarywilltellyouwmm Ian. phasecallSt. Hy umber at Metropolitan Ibepital 18: 945300. Ext. 720 (708). At the Wivemity, the number is 876-6500, Ext. 1455. (That is the Quimm's number, and his secretary will mmlly know Wt Mmlmnm‘willbeabletotmamsage formmtilIhave my am seminary.) ‘ �Mr. Zwahlm City. (emtinuad) Thank you You mat for the invitation to visit you in Atlantic know that I have anjoyad mm mlatimship ﬂuttmdatawillwmtyowfaith inourmrk.deI'npe Idolodcfomardtoemtinuingtoworkwim vars/mien, specifically with Dan What. You may be interested me of my responsibilities is to establish an Early Clinical mug Evaluation Unit with both in—~patient and cut—patient facilities. I nape that I can amplish them SK? and to hm that mtlhavetriedmacaauplishm,andlookfomardto My best regards. Very Fink, M.D.' Professor of Psychiatry Max Mfzjm sinmmly yours , � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Zwahlen, Robert C. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-274 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/88fa15d9ef77c63c9fad737686f7f5b4.pdf 16de320c5d347e805cff4222f281e284 PDF Text Text m2, 1956 Wham: Impassedmmmmdnr.mwthmeh1tz mmm W Immw.muuuwmmmummmm Mmfwmmmm . Kim‘s... tar- A. , meantimrnmmmmammm ammummtmmyarmwsum Wm. Aujwmothissmdiesmmmdte W m w,mdmmﬂy.mmwd Hehasnndesi Wemdnmpmses. cantvihztimaafhethatedmiealmd mums mﬂmﬂmmmﬁuqmutyothismmm cxosllmt. I‘xaveviaitedhislmummdrfugability »» the mammwumyu, mmmesmthsmﬂmusualmtminingofu wxuidavnlnpmximlequtmzt , high. WW.MWMWM®WW Iduheliumﬂastheeanmake Imuld magmas-macaw. mum ac: Knuth Lifelike, Md). eigmiﬁomt I � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Ellingston, Robert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-273 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/184b3a3f3a238df87668ec71e33d89ab.pdf 122252bf792a6599efefa267b3e94206 PDF Text Text May Estelle Dr. 2. 1955 W11, librarian Meal Library Washington University 660 South Kirxgehiwmy St. Innis, Missouri; DearDr. Bremen: I have mad with great interest the reports of yeur matings with the Intemnivereity Conmmieetims Oomcil. and especially the proposed develepnent of a mime]. network for information handling and retrieval. I trust this program will go well. I emwitbxg to extenduymimetim in the (Jemima for Emmivcmity Cmieatiens Cow-sci). since I have in order to swept from the Selma). of the posit-ion of Profeew of. Peyehiatxy at the NW York Hedioel college, effective June 1, 1966. with all my best wishee for the emoeeeful development of this prom. I remain, 7 new mm Sincerely szmh we, PM, ”.13. m Professor of Paydzietry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Brodman, Estelle Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-272 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1d0ba2e0acfe6f73bb21a3041a09b821.pdf 00ee49702b3a18ea38db06d3bce7045f PDF Text Text May We“ LI KWM. 2, 1966 “‘DI Assistant Professor Dapamnt of Fsyehiatry New Jemcy Collago of Medicim and Dantistzy 2“ Baldwin Avenue Jersey City, M 1!». York New mm: W Thank you very moh for yam kind invitation to participate in tha posh-Waite of the New Jersey College of Hedicim and Dentistry. It was kind of a». Dahlb'em ta mammal w participatim. and I would be pinned to make whatever attribution I can. subject of the gamma]. and specifically. the nemphysiologiml activity of 1.31) and mum 3&1).ch is one that has been of midemble interest to me am! my associates The forﬁwmt ferayeam. Iwmldbeplamdtodmmsmwork (What's. and the available studiesby Effective June 1, 1956, I will be at the NW York Medical College. This will make: my participation bath easier and much less expensiva. My We. will ha: meesaar of Psychiatry Departmnt of Psychiatry NW Year-k Meal College 5th Avem and 106th Street Maw Yak,_Nm Ears: 10029 Thank you once again wishgs in a amsaful for your invitatim and mm. best Simmly yam, Fink, NJ). Professor of Psychiatry Max Hfzjm my � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Kurland, Morton L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-271 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0d1c81c61acaf08f8ae661810eebb72d.pdf 5b44ac44a46a19f178e741095895440b PDF Text Text May 2. 1966 W]. Indistxy Maegan - Medical. Mr. F- A. IBM ' _ 112 {Last Post Mad mite Plains, New York 10601, Dean Hr. Powell: for ycur lettnn of April 22, 1966. fact that I will he mlccating in New Yam, I taupe that the ccllabomtion begun have with Dr. Donald Shapim (who is reheating at Washington mimity) will permit us to a suitable demonstration in 1967. Thank you vary much Danpita the m mthmeklhcwtmmgotiatingwithtm mpnaaantativcs in Na: York mending the pcsaibility cf «obtaining a 1711 and 179% frmt and cumin: fan the presently available IBM 1620 pmsaor M: 1:11. New York College. I have emphasized to the local representatives that the availability of such aquipmnt will maka ponsibla the ccntinmticn of the ewlomticna which was have begun in St. Louis withut the nccaaaity of axpenaivc and time cumming mpmgmwing. IBM mm As IwillbetmnafaningmcfnyatudicstonYczk. and since: the (18% is suppontmg this pnognm for conputcn services at a amthly rate of approximately $1100 for aquipmmt that a continuation mxtal. I believe that I could mince of this program in ﬂaw York at appmximtely the same rate muldbea lcgicalcmﬂitm of funds. While itwouldbc m W vazymasmabletomqmatsuppcnt fwafullunitcfanIBH 1800, I do mt helluva that our study in extensive such a facility fun a single user. Rather, enough to 1' believc we can contribute heavily to tha {mammal from New York Madical College for an IBM 360 System. Weaver, this is sanctum in the film, and I an writing to tell you these details became in my diamaaion with the IBM mpmamrtativa, Hr. Robert Shannan, he indicated that my present suggestion for such an upW‘wwld be difficult to achieve and thought hemﬂdcalltoankycm'advicc. Imuldbamtaful fonany asaistm that you could give him. I will be in touch with you late in the Fall. Wt ‘ Sincemly your-s, Fink. Mal)Professor of Psychiatry MEX mnjmh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Powell, F. A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-270 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/df0dbda54f257ca72b6fd1a803f41bd6.pdf edfc2fb6d549fe3010ba57d5b9fd6db8 PDF Text Text April an Phillip 25,, 1966 Bradley The Phdiodl School Elimination, England Deer Phillip: I have devoted the past two days to reviewing the manuscripts available to me. and in preparing a summary of our proceedings. The manuscripts and my nous are going out separately today. There is one special question is related to the too dommnts of invited participants. Ire. Ilymhendc and Jermr. whioh were not presented at which the meeting. quite . I e have found that Dr. Ilyuohenok’s manuscript id amend its inolueim in the proceedings. good and would With regard to Dr. Jenkner, I ampuzzled.1 have available a four page abstract. a copy of mic}: is enclosed. Wlbelimthetmoftbemteﬁalwouldbequite relevant to the discussim, and, as it deals with a peculiar state of altered omeoimea. I believe it my be considered for inclusion. Harem, I do not have the full manuscript. and this would have to be solicited. It wand be a. delicate matter to solicite the musoript and than decide as to ite suitability. I am therefore bending theebetmottoyouendwould suggest thetmdowite'to no. Jenlmer asking for the full madam. perhaps providing new caution that it should be submitted for consideration for Mlleetion. If you concur, please write directly to him, or I will be glad to do so. Inﬂuemuswipt whiohlheve justreed, lemmeking neither editorial ohnges nor oomotim of style. since the smoifio guidelines for this volmae are not available to me. I would be glad. however, to make and: editorial and typographical suggestims if we can agree on the necessary style guideline. Sincerely yours. MF/jnh Pink. “0-D. m Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Bradley, Phillip Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-267 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/84c77991d91cb9d76f6ce38170650713.pdf dc37ed02ae94eb0f36c948f0bb46d861 PDF Text Text April 25, 1966 Joseph Jaffe, Chaim PM). on Research Mixes The of Paydmmlyais ‘W 125 East 65th Stmet York 21, New Yeﬁc New near-Joe: Ihava just mmivedmdmdwithpm the on practical aspects of monarch in office settings. I fomd it 5 6011131th and easily madiblo waive, dewdshtomxdyou, Claymsmymajob wallchm. IthinktMommts mgaxdinatm on therapy and the special problem of single case study we amnllent. upon Wot mm MylmggestﬂmtthisbonMavmahlemthe mamhipasamportofm Mitten-3. Simmly yum, Pink, H. D. N meeasm‘ of Psychiatry ' msjnh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Jaffe, Joseph Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-266 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/567654155ada1cec7588daef58900695.pdf 9c17b9445c52ee29515a4b1babaf0a15 PDF Text Text April 25, 1966 Miss Danna La Rock Sandem World Travel, Inc. 925 Building 808 15th Street, NM. washingran, D.C. 20005 Show Dear Miss La Rock: ‘me itinerary in your letter of April 21 Planes proceed with the necessary mmts. is satisfactory. mm you for your assistance. Sincerely yours , Fink, H. D. Profesaor of Psychiatry Max Msznh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Sanders World Travel Inc., Donna La Rock Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-265 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9f2f3b0c0166c56644a4fed844f7074a.pdf caf0c284c3007fbb05d5ef3953639b4e PDF Text Text April 22, 1%6 H». G. H. Goran Dapmm of . 4w]. Engineering of Rochester mimity Rochester, Haw York 1&827 mm. Dr. 00318112 Fella-wing the mat in sauce of February 25, MimMImpleasedmsubudtmabstmctdeamibing 1966 our dommntatim studies for yam Rochester Gad-Emma. mMemtim for the hmmwthntﬁaiasumymhasmwpmmtothe processing and mtmeval. problem of bamdioal 11mm Wamtﬂﬁsmts to jcinmg you. wiﬂzymmappmvalmdlook forum Sinosmly yum, ﬂax Fink, NJ). Profesaar of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cohen, G. H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-264 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/2c143c37bf6c3fb663955ee30aa6a38d.pdf 18fb28058539369c547a17a81481b6e0 PDF Text Text April 25, 1966 Dr. Jana-sen O. Cola Natimml Bank Building 6917 Arlington Road Bethesda. Muslim Jmﬂm, $11381 I awaiting to you as officer for BEL-11381 to bringyouwm-dam an ﬁnpmmt state ofthis project. Dear RE: 13ij w.'nm1tilmsbeenaprincipa1inmtigatormlhave bamdeliwmbausmmadwithhmmﬁmdevelopmnt ofthisstudypmm. Appmximhaly fort-y patimts have been introduced into tin‘initialpmmmmaddiﬁmalmymmbeing The mkyaioloﬂcal, psychophamlogical massed. and clinical aspects of the first forty patimts are now minted. MWmdfollowwdammnmbeing obtaixnd. 1113 Wichgieal M of subjects am under intansive md pharmacological study. second Effectim Jam 30, I can no lmgar continua fomally as wizmstigator. Dr. Itil md I have considered the possibility that mntinuationofwintomst inthis studypmgzmnaybe pmvidcd m advhoe. consultant basis and I have indicated that ImldbeplemdtoassisthiminmymythatIcm. Myltahethisoppomitymthmkyouforwursuppwt Mmmgamntinﬂradevelomtmdmntinmdgzmthof thiasmdypmm. Sincerely yam , Fink, 14.1). Professor of Psychiatry Max ac: Dr. Ulett Dr. Itil � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-263 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/142bbd1a74f155e1c6b5f73906434e43.pdf 1d3ebb7c1c685dd8f9df97017a5ee043 PDF Text Text April 20, Dr. Jauthm 0. Natimal Bank 5917 Arlingtm 1966 Chin Road Bethesda, Maryland Jmaﬂm, Daar IE: Iii-41380 I am writing you as project officnr for Iii-11380 to bring youm—to—daucnﬁnpmmtstatoofﬂnpmjact. AsI indicatodinOctober,IwillbolaavingSt.louisaarlyin Atﬁuttim,ﬂudataoollactimmdmofﬂndata arulymwillbomlam. Jmo. mmwillbefmdslaﬂinm~11380andmmccming Maulyuacmmnﬁnmmdarmaupmisimcfm.Itil. Fwﬂﬁsmmlmmstadmmmiwmitymdm writing to you to momma! that Dr. Itil. the eta—investigator of this pmject, be appointed principal investigator for the Wimdﬁupmjectpcriod. , mm,m1imimtadﬁzatmenmybam marminingmﬂmtmwmadbchalpfuItomhm the malyses $.an York, mam-y woman-es forﬁnhandlingofymtfmdammlocaﬂmcfﬂnprincipal be fbnoud. You may mean that the mimity suggestadmdtemte thatofasubcontmct. ’mis iner 1:»quth mm, canned agmaabla. although novel. Apparently. ﬂuwitingofwd'xaomtmctmnovelm the antiwrities at the adversity of Nissan-i and to this date, mamhmntracthaebmwritm. Mpmjmdbalmmforﬁn want at the period, September 30, is estimated $8,000 and $12,000. The Assistant Chaim of the mam ham Deparwmhaaasamdmﬂutmofﬁmseﬁmdsmyyet bawailable dtn'ingﬁnamrmnmspmvidede couplem tha necessary legal steps. 'v hwmmmmmMymsatmemmmmm of Payohiauy installatim, I balim that much of the statistical work can be acmlished at Hashingtm thivamity. Drywall Stmpim, �April 20, Dr. Jauthm 0. Natimal Bank 5917 Arlingtm 1966 Chin Road Bethesda, Maryland Jmaﬂm, Daar IE: Iii-41380 I am writing you as project officnr for Iii-11380 to bring youm—to—daucnﬁnpmmtstatoofﬂnpmjact. AsI indicatodinOctober,IwillbolaavingSt.louisaarlyin Atﬁuttim,ﬂudataoollactimmdmofﬂndata arulymwillbomlam. Jmo. mmwillbefmdslaﬂinm~11380andmmccming Maulyuacmmnﬁnmmdarmaupmisimcfm.Itil. Fwﬂﬁsmmlmmstadmmmiwmitymdm writing to you to momma! that Dr. Itil. the eta—investigator of this pmject, be appointed principal investigator for the Wimdﬁupmjectpcriod. , mm,m1imimtadﬁzatmenmybam marminingmﬂmtmwmadbchalpfuItomhm the malyses $.an York, mam-y woman-es forﬁnhandlingofymtfmdammlocaﬂmcfﬂnprincipal be fbnoud. You may mean that the mimity suggestadmdtemte thatofasubcontmct. ’mis iner 1:»quth mm, canned agmaabla. although novel. Apparently. ﬂuwitingofwd'xaomtmctmnovelm the antiwrities at the adversity of Nissan-i and to this date, mamhmntracthaebmwritm. Mpmjmdbalmmforﬁn want at the period, September 30, is estimated $8,000 and $12,000. The Assistant Chaim of the mam ham Deparwmhaaasamdmﬂutmofﬁmseﬁmdsmyyet bawailable dtn'ingﬁnamrmnmspmvidede couplem tha necessary legal steps. 'v hwmmmmmMymsatmemmmmm of Payohiauy installatim, I balim that much of the statistical work can be acmlished at Hashingtm thivamity. Drywall Stmpim, � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-262 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/73bb095434878f5f0045c8310785e16f.pdf 8eb018b1a62328a6aa8df9a7dd8900e1 PDF Text Text April 19, W Rpm 1966 W. P. mm Aasociatc Professor of W109! Why Wm or “ma mivomity of Medicine Dentistry Rummy W113, W863 38103 Dear Dick, wtmtmymmagainformpmicipntﬁaminm mSymosimmdfor-mmxyvaluableomﬁibutims. As ﬁxinpmayhave told you. Elseviorhas lish thase wgsasawlminthei’ummainﬁmén “tuck. Wm Immmmmmmmmmmtyw in ywr letter of April lat m6 will send it with the wanted other maswipts to milip this week. Again, my bust regards. Sincerely yours. meessor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: White, Richard P. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-260 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7ae027131db9fd4157421cf1d88f4790.pdf 058fe09738d81e6b167d16b59ce37463 PDF Text Text W1 mm, 19, 1966 Implnmdkdﬂmmoutmofmdiawsimawith mmwbunntimofthnpmmdingsma voluminm,mdmwithﬂuprommswhichyw have mtlimdfnrthannuncnipta. Whimtmorigimlsofﬂu Wptsuithﬁnirfigwaﬁwmtswﬂlbomm ymwiﬁdnamk.ncﬂmtﬁmmiclcsinwhmdsmuldbe inmglmbyﬁnmdnfﬂnmﬁu. Iuphmmwriuasmydimdmmdwam mitimndiamly. numeromanuinymmmmm Ihnwmtﬂnmmipu. Youdmmldwiumm. imp, W,Wikkr, Jacobean “Jasper. Sinuvmwioinamigtmcringsummdhad Wmmmam.1wcﬂlhimif1dnmtmiw amwiptwithinnmubhtim. Yammtinnﬁwtﬂiklnr'sropwtm pmvidamintmdmtim nyhnutisfacmry,butlwou1dlihtowiﬁzholdfimljwmmtmtil mhawhndamtnmmwmcfhiarmﬁm. etc. animus, alumna of proofs, indexing, mm mmsmtﬂmldamitmmﬂm '33 InuitingfmSt.iauinmdmtilmmdofmy,thia hmmrimms Aachmlst,Icmbamd Hams: Mica}. college. antntPaychiatry. mmwmmm.mmvmty.mvork. . Ilcckforwdtoccnabomtiminﬁﬁsmm. Simemlyyomw. Max Fink, PM). Professor of Psychiatry mxp on: Marque Dr». 52 Vamrbilt Am New Yak. Nu: Yam): 10017 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Bradley, Philip Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-259 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/363b671f8bc93db18fc62a4747a0b5ff.pdf b9c21e81facbe677bf1367b79cf071ac PDF Text Text [@2311 11‘. P. 1.. Garltm “me Squibb New Bnmcwick, Hod Imtim for Nadia]. 08903 Jersey 19, 1986 Pam Dear Dr. Carlton: First.letmtalmth130pporumitytoﬁmnkymfor tion md ”Wm on mtidnlimmio drug.presentation at the GIN? amazement Imwritingmtan-ywthatmlmmboenabhmmke 1315: with number to publish mmts Velma of Magma M Rum. 28 you. 06 swing as I tmst this pleases mwitmmasmdmatmuymgetﬁmmuscﬂpts toﬂminfﬁnlfombyﬂnfimtamee. Iamwriting, Mfm,tomqmstaﬁnalcopymdfigumsasaomas possiblc. My thmks for your cooperatim. Sincerely yam, Pink. PhD. Professor of Paydﬁatry Hm: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Carlton, P. L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-258 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c78f813c035174f29e5b5759a3fdf03a.pdf b6dc37731ea2c8c49d518875e5f4527e PDF Text Text April 19, 1966' DP. Emu E. iﬁmich Dimamr, Reneamh Divisém State Ream Hospital ' Illinois mar Mold, Galesbwg, 61%]. uthywoncaasainfot-ymmpmicipaﬂminﬁu were most helpful and I Yam Swim. (131th mmmmofmmjoyodthmtingwwm. CINP Wehawbeenmsfulinm‘gingwiﬁxmaevierforﬂn mlwne in publication for the pmomdings of this Panama in 8min launch. symposium as a Inmspammymmhttoroprrilﬁ.Ihavemplamdtm mvisedpageslﬂmdnmdmadditmlrefemeeasywham mmtqd. I believe Dr. Votm is visiting yam muful if I wand 1mm andmngemts you would tall him that we have made the have request-d that the manuscripts with Blunder. The be in thaiz‘ hands by June 1 so that publication can he assured befom be minim Imuldbemfulifymmuldaskm.vaa ﬁnendoftheyw. send his m as soon as practicable . to please Wipt 130 Thank you. Simemly yours , Professor of Psychiat‘xy � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Himwich, Harold E. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-257 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/66c27180cebaa46c9de8a38ef5adc217.pdf 7a2129138dd90419a5f237d1e176fe17 PDF Text Text April 19, 1986 mm of Musicology Manor of of m mimity DmtiatryWm It. Richard P. Wm Wt Wm Anemia: Win, W 33103 Dear Dick, thtmmmmjnfmmmmmmm A: mmmmmmmmmumumm. mﬂipmyhavetoldyou Wierhasaﬁaedmpublishm inthe - 58 as avolm Panama Bum Munch. Ihnwmdnﬂumatiminmmncﬂyﬂﬁntyw WmmmhmrafWMmddnmitwithm curmuom‘iptatomﬂipthiamek. badmgybostuguds. Simemlym, Max fink, NJ). Professor of madam � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: White, Richard P. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-256 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f42d0ba83062a129ecbf8b5fcc8768d3.pdf a61252beea3701cdf5c48be05cb1a110 PDF Text Text April 15, 1966 Mr. Robert F. W Hunting lbwemative International Busing” Mines Data Processing Division 220 New am Strut York, New Oarpmtion Tank 10013 Shem: m.Cmulisquimcomctm1amverymintmmd in mm processing ofommdata. mmmes inmlw on» umpmeessinganddoes imam; malog mnvemim. Form ‘ﬁmﬁxmeyammhmbemamdormmmesmdyofﬂw qmtitimimofmmulogsim. Ramthmdesm‘ibeitindemilinaletmr.lmuld suggest ﬂut‘wa discuss thaw applicatims at ﬁre-Meal College. Iwillboﬂaﬂewhrkatvariwstimsmgmnmmomm, ﬁrpoﬂocbeadmmkmtoﬁmdayu. Mmm'muldbefor Dear Hr. mtocallymuﬁmgafmmmdtyforyoutomit. Sinoemly yours, Hm: V 141':qu Fink, Way 191.13. Manor of � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Shearman, Robert F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-255 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/eba52bf0703d8edcda4cb7c498f56d3a.pdf d18de3e11b74bf6273b5b06863cda410 PDF Text Text ppm 15, 19:65 4m » 230mm www.mms: M W: mmwwmtwnmﬁmmmmngmu fwmmmudm mmtontiminSom :‘ Mr. WW mummmmmmmnawmm Madmamnndmﬂnd WWW mamwammmmmamamm mbnlinvnuun Wmmnmmmnmimgmnmh :nmmmmunmtmm.mm an mthdeW. ammummmmmwum.m winhnplnundmmdﬂyﬁaciuﬂmntoﬂtﬂnntylnnf sammmm 351ml)! yum, ﬂue may cc Dr. Itil PM. Mum 24.9. of Pnyamntry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Wheeler, Stanton Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-254 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/75e83fda3621929cb6bd5fd0ba70636e.pdf e10252b561a0ef5d0589ee7befeb1f8b PDF Text Text April 15.. 1988 In mmtamtrmughmwurmwu Mmmimumtw publicationin Wimuwmmm mmmmmmrmknmmmmvimm 03‘ minimum WRWWM WW,Imetﬁulonmm “Minna memwwmmwmm amwmmtwmmtfcihmmﬁmfmﬁmas mmxmmwmmwmmmwmmnmm Minnow-i. «magmtmt. hmmmwtmytmmmumy' Ibalicwtlditicmicaw conﬁnhmMaoWﬂﬁcm. mamﬁﬂmooa mm! WWW oxyatalliaintoronitciotwm,thvwiayotopinions IMWWmMﬁmMWmn lithium mammwdmmmmm.mm1mmm aimimmtitﬂnatyiaotmm Max Pitt. H.D. Pmtcaaorothyohintry cc: Dr. 11:11 Hrs. Pmilich � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Opler, Marvin K. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-253 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/47c93caf44bd4e83dc90ce922b4e63ae.pdf 1cbfe65f3f7543db393d28af5bbd299b PDF Text Text - April 15, 1966 Mr, Nmeeymsas max-mm: Wediseetetmtfmm.mwminmmrt WM ImWMMoﬁWeMmdﬁn «$371.00 fwﬁnMMymsMMswliedinm fimtmportofﬂwmsultsofthiao‘mdy Mammwlms thmwmmuthemmmbeammm WWWMMMﬂm.mﬁwpmmdmgs Incidentally. Iméd-wiﬁxmdisma the report cumming ﬁnuiﬂxmlofywmmm. ammmmmmammmmwwﬁmm. "jﬂaisiabutlmﬂnrmmk ﬁmﬁymmymﬂformooopomﬁam. Bimerely yams. m m; ofNJ).maxim Professor 19:19 9.8. I have M mind an Weak-additional reports. m you. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Burrell, Craig D. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-252 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e48705a8e87250026c65807ba823d434.pdf 333252bd01b86f4fca479b5b654e9423 PDF Text Text April. 15, 1966 w.h~iatideH.Eem www.mummWMMRII Neal'ork W. mmmz V memmmmmeum feasibilityortha queatifloatimofmectivetimm iamirmm om. ﬁewmmcfmmwwﬁchmmw ulthWhtW“md”ems,“whimmims midnxtﬂmdasstetesof“activctim“cmbemumd misled a setisfeotcry minim} is eeteblisted. men is a we: deal of evidence that the rapidly mdmttmrelatmnshipeamverytmamins We see: sample ammo in behavior as mtel axittmetic both simple cf twin am couples fisums, mention to visml or auditoty Missal. etc... and «melee. perceptim mess swine vorjwreism 3.9%?) and (Wt cf the train). fer my years have been nestled out and are Iwmldnugsentywseemvinws bylaw Lindeley in 196.1 (Elmer’s book on atimletim Wetevemintemntcdinmspmblemfmthepomtof mwmmememmmmoreemm. mmmmmmmymmm W133 ‘- mmmmmmmmmymmm byattmﬁmwatterﬁcw. Immfidmtmatmymcte ofecalpmmruedelectricaleotiviwmrelatedtottetacm ”mememmw ﬁrmly we, m, of Psychiatry Manor Nu on: m.Hatth.Klim 14.13. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Esser, Aristide H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-251 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/13a09a9f228378e701e0e1a6c38d45f8.pdf 28fcf33ce891a0c8cbf6c3ff3eaed227 PDF Text Text : lope: It. IV World April 12, 1966 Ibor, Presidant Congress of Psychiatry Calla Mocha, 106 rum-1d 12, Spain M m.» m: Idid smdyou abstracts as mqunated by Dr. Vallejo Najera. thusWIWtﬂnmmbempmblam, If the rules of the amtdbutim as magmas limit participatim. I beliave official discussant and in the Roma Table will probably be of greater intervst both to me and the audience, than the open micatim, which I hereby withdxw. my My an best wishes for a successful (bumss. Sincerely yours. m; of Psychiatry meassor MEX Hfzkp Hon. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Ibor, Lopez Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-249 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/cbea38be81b0679447f131696c4eb602.pdf 03780fce7513d6e74c6ff4b54b06e77b PDF Text Text mm 12, 1966 Mam W Chum Miami Institute of Mr. Assistant A. sues Arum). Street St. Louis, mm Psychiatry 811.39 mm, Wmmmwlmmtimmqmmmmmd inmmblodimsimofkpriln. Itmwmmmngofmmmmﬁutymmm unmitymammmtmormmmmnasom. mmmwm mumwmae. MWbom. “mema0,mw.ﬂitiatobnmlem,haw mumm. WWW.IWWtMyoumviwﬁm «mmammtmxmﬁmmwmm mdmvidufammmlymiﬁmfwmminderof the wt. effect“: m 30. Shandy Fink, yours, A mm of may Max 14.13. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Thompson, Warren A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-248 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a0196a6a04b986b15342d51b9c388317.pdf 05b4b3d61d628f450cdba4110f5b5426 PDF Text Text April Dr. Film: More}, Gummy 1’8me 001103 Wm Pall, 16.3mm St.‘ 12 , 1966 Editor 55101 Dear Dr. Sanford: Zubin, mmmmmumtmmmmmMmd volume. "Psydwpaﬂnloy of WM.” I failed to moaivu thn .WhanImmimdﬁnmm.ttmmclmedmviewwaswittenin ﬁnhopeﬂutitwinmtwimmappml. Immmwhmmlm.mtdidmtenjoyitm1f asunhastiﬁsmkwhmﬁﬁsmviewwaswrittem makingthe W“ofavolm,wmldymfmmwithamitiaimof Wamviw? mmmdmmmdmﬂmammimrmmd. Sinmlminmitim,Masmmvimmaythmfom Jm.1mu1dappmaimmrctmtomymwpoaiﬁm,ifmy ashofwaarofpsydaiatxy,Nw_York mica Wham, 0911.53,):«Yonk. Myanfarﬁnoppmmitymmadthisvolmmdpeﬂmps, mmmmmm. Sinamly your-a, HEX Pink? H.13- Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Sanford, Fillmore Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-247 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/566b20500ad02d02a477394469c7af58.pdf ba92d5bdb37d4fe15d8d28d6b5553acc PDF Text Text April 12, 1966 Mr. Robert L. Robinson Public Infomticn Officer Mexican Psychiatric Associatim 1700 Eighteenth street. NR. Hashingtm, D.C. 28009 Dearﬂr. Remnant: Thank you for the apportmity of editing the discussim of membrane. Ihnwmtmdmmeofmymmkem The suggested are the W, I hope. style. inserted on page four, discussion 2. mime Sincerely yams, Max Fink, 21.13. Professor of. Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Robinson, Robert L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-246 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6ce34db42e2887fabebfd439e814d454.pdf b6637bedb04677953f19e655b36db1a8 PDF Text Text April 11. Dr. 0. Jmﬁm Bank Natiaml 8967 1966 Cole Building Arlimtm Road Bahama, Maryland 2001a Dear Jonathan. RE: ”141380-02 Mammpriam ofﬁcialsofﬁnlhimityofﬁissmm, Eula have approved my mqmat to participam mum» of Payclmlomr, Augusta—11, in inﬁnlnumimal commas Moon. of January 7. maybesufficiant, I includﬂxg Wth maummﬂymmdmummﬂdamwpyofm umlauﬁmizatimorhxdicauinmoﬁmwhtewaythe appmvalfortlnexpmditm ofﬁnsefmdsfmm—IIBBO. My thanks. Sincerely yours, Max Pink, 14.)). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-245 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d47a64bb66b0d69431b1974ab328df25.pdf 352f0950353fc4453a633182d932fad0 PDF Text Text April 11, 1966 _ W W (binge Fifth Am at Strut New 11'. “n York Radical New Yam, New 106th York 10029 MAI. Iumtﬁmtymmmtingswithﬂlﬁllermmwn. metmkmMchmmmmdiﬁMfm inwatigaﬁ‘pne with cyolamcim. 'Iho Watims am still misunt'deamquimplmdwiththestMyaofw. We mmmMHimmomdsm,mtofWiats. Iwiuﬂyinmﬂcwfokammingmdwinm Asymmystillbein tomtxwonmmmﬂaymg. CalifomiA,Iwwldhamfulifyouwou1d1eavemmml WMMMmMthmmwgemm Mdaywmauy. 31m Aslmtiaud,1hwebminvimdmpmicipataintha April 21mm. visitatﬁﬂmmmdaymdrriday, the festivities with Dr. Bleultar. miswillmuimmmmiaa Immtlmybeemed. Ifwaoelmtitismm valmbhfwutobeatﬁnmmcomgeatmtim,I wﬂlmlaintom. . $5le your: . Nam Fink, NJ). meessm of Psychiatry Wzkp P.S. WyouwouldlikotostopbymymmwaytoCaIifomia. Iwillbo availableaumkmtil Friday evening. 1mm! beplemdmsrmywaboutﬁxehbomtoriwhm. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-244 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/217a82501368952124c104a3b4692b9b.pdf 69adc79b3b254d3cd9bb29e004bc0833 PDF Text Text April 11, 1956 m. T. P. 8. watts Guy Rwandan 1330 P. O. Box mm, New York 10702 ‘MPaddy, Latmﬁmkyoumagainfor-ymmkindmssforinviﬁng mtopu-tieipminthodismliamofmﬁngmatmcm matings. I onjoyod the dismim and the subseqmnt meetings mam. leIhawsmtyouoopiesoflemmﬁutI hawwrittanmm.mgstmd8dmidlin. Implmedmmlmampyoprmpmedpmmaolfw thialwahatimofsr-lss. Wavinmdertakeﬂnpmlimim inmﬁaatimthismkmdshouldmmdatawithinﬂnmth. Imﬂdbamtafulforymmariticimmd suggestions. Sincerely yours. Max PM mm, mm Professor of ‘ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Watts, T. P. S. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-243 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/da8e5e5f7ca4f422da237f86faf3485e.pdf f603adc3857e736b25ff628d19ab1cc1 PDF Text Text April 7, 1966 Dr. P. Scimidlin 010 J. R. 8. A. My mm Wﬂmls 8:310 #080 21 Switmlmad W: ut‘mtmwhmamiwmﬂmkwummmfw at: Dear Dr. sit/$1M}: mmimitnimtowﬂcipatemmeeiymm mmmmtm.1fmmmsimwinmting meﬁmmlyplwdmmmpmmewhichmm pleasinymu'pmminEum. ”Imm,wmpmiwlerlyinmemmme dew/elegant 0f rating scales. I am enclosing mmlmm empyofmmpmmtmﬁngmmmnstofdeﬁnitims Mmhemfwﬂlmlpful Atthepmmttim,wem Meweeothetitemhetmlatedbymoptiml mmmwwdmmmmwm Wmofmgmmmwm. AeIindioated.Weewciete,mnmItilandIm metinmminmmdewlomtofmpmm endwinhywtmbeatoflmc. _ 311mm yours, Pink. Md). Profeaaor of Psychiatry 1%): Mthp on: m. T. P. 8. Watts � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Schmidlin Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-242 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a22adf4b5c61efe6408091ad4eaa8f27.pdf db39c5b7d170871525e5b2cb8aa069aa PDF Text Text Apm 7, 1966 Dr. Jules Angst mm Mob Paydtimiscm miwmita‘tsklinik Zurich 8008 31 Switzerland withyoudwingtmaiwmtm party Ihavnmvimdmofthe «Magaimwmotth' .-+~“='Sclm1d11nlcftw1thm. Imtaking mum-tycfccndingymocpicsofﬁupmmﬂngacahm mllaaamtmimmpmmmdatﬂuﬂﬂywhichindicates ' - mwcysinwhichwammingmissoale Inadditim,1mmingymaccpycfampor¢w1tmna fmyomagodacmdbingmomﬂomwwimfactormalysis “WWWIWmmmdobcmrwﬁhcﬂnrmchniqms. IMmmomisawwimtaumeouldbc plemdmusistyouinmywayﬂmtmcm. @ood lmk. Sincerely yours. Fink, PM). Professor of Psychiatry Max HPﬁcp Wale Wm, cc: Dr. T. P. 8. Watts @3133! P. 0. Bow: 333 New: York 10702 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Angst, Jules Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-241 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/71832a146aad332a01099bfe8de59534.pdf 2589c79bbc5d32b904f30f489f78b4c1 PDF Text Text April 7, 1966 amt! We: M Dr. Ivan P. The Lilly Research Eli Lilly and RR 18, Box 285 Indianapolis, Indiana [has Ivan, Iwrymchenjoyadmlmminmshingtm,mdwhile mm Idonottmnkmtfurmrsmdmuichloseﬁmssa its possibls mmpeutic agent in m mud. Wemnow masamnuslstimlantstﬂlimﬂgmsus. collatingmdatacfmmsmdymdfindtmtwmm I mariting to ask you" clarification. omfussd in one regard. mums; to the Physicians miﬂmrmnmrmbm. is listed as Massimo-3» _ 91M; Win ‘mimdwithiaadszid madman, i . We 5.3 had intmpmted the mismmimnmas indicatingthat itwasthu 2)me m-mieleswittenhyeaorgom MappemdinSemmycin. also list his use of D form. In our dismissim, I believe you the ﬁxture. Dbefam indisated that Sammycin is Canyouclsﬂfymichfommhwebeenming? A150,]: mmsplmdﬁmpmdmtdesmiptimmdmuld mquestymr sendingms Wrifiﬂ: is wailable. Myﬁwrks. Sincemly yams , Max Pink, 1-1.1). Professor 0! Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Bennett, Ivan F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-240 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3fcb972e3d54e973c4879b786f6d3b55.pdf 160826c469b23da266b2b784c9a18273 PDF Text Text April 7, Dr. Eugene Luke: 01mm, Ompum W W, Research Facility 1966 Wt State Ebspital New York Dam Gem, maimed is a copy of the abstract which Don and I have: submitted to the Warm of Psychiatry. I would appreciate cumin-ac at the World your notifying the appropriate Was ﬁntmnismmﬁmforﬁnmmim, We auditwwldbo appmpriateifhemaoliatedintmpmgm. We will prepare a final museript diving the next few weeks Mtrytomtthemtlatdudljm. Immtsmaato'me mammdmtimmdmldapmciammmmm m. V Ifldomtmmyw. Iwillaasumethatitis appmdmataly 20 minutes in length. Again, my thanks format-kind invitation. Sincerely yams , Max Fink. 14.5. MW of Psydliatzy � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Laska, Eugene Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-239 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3dda7ec3aac30a30700c066763cc7cb0.pdf 7a59530989e2870d0e273273ebe2047e PDF Text Text April 7. m.m.inosm Chaim. 660 S. Department 1966 of Psychiatry mimity 801ml of Pbdicine St. wuisigmssmmi harm.lbbim: Asymhm.1hsvnbmhmomdbyminvitatimto join 13m tawny at tbs M Yes-k Medical college.” memorofPsyeMatry,mdwmdssostﬁwendofthe Imtsking thisopportmity effective Jme 38, 1968. mt of Psychistry.W»mmmmzmmmmpm~ ﬁrmly my, w Max Fink, run. Professor of Psyduiatty ocznamH.Konthing � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Robins, Eli Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-237 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3cd4ef6b384e0a7a2220fe794621fe09.pdf 4b230accaa76b8855ac2464a8277edfc PDF Text Text April 7, 1966 ths m. Hilary Demon, Editor Scierm Books: A Quaruerly Review Avenue 20005 D.C. Washington, 1515 Door Mr. Benson: Imuldheplaased’oopmicipatointhemviwof in medical sciences md psychology, as mqmsted in the must issue of the bulletin. Good luck in your raw madam-admire bodes mm. Stately yams. Max rm, Mm. Professor of Psychiatry Mfzkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Deason, Hilary Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-236 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b5432c324330be9d4091d9c8bd0d8ef2.pdf 7f789aafb61de323d5e0bf526cb89a8a PDF Text Text April 7, 1966 lands 8. Stuart, Pmsidmt Pomdnticn Psycmatric 22 Fair Oaks Mr. Rum m» 2“, Missouri Baum, Asyoum. Immmmbyminvitatim tojoinﬁnfmltyattMNwYorkMioal Colleges: meeaawafhychintry, andwilldo soattheandof in I m, thumfom, We latter of animation Emmtive tho want submitting this War. yum June. effective Jun 30. 1986. as Insofaraslwillbeinmitimdxmingmmxt fewmnm, itmuldbeofmistmmmm‘kof the Pmdm if a mu Hammad“: Director were animated 1:11: responsibilities for the at this noting to —- um Pamdatim's affairs on or about April 15, 1986. mylmmhomitytoﬁmkymmdm umberoftrnhouwdformirloyaltymdstxpportdtming “charm. mumyou. Ithasboenaplmmmdmhomr . Shmly yours, Max Fink, M.D. Exam-the Dimctor � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Stuart, Lewis B. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-235 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5b2500bf0f86b3eaf514b9a2da1ff4ab.pdf c201115d94865c914842df18fb6d0d4f PDF Text Text Mazda 25, 1966 Ginny R. Smith Q‘liﬂf . Grimm Hanammant Brmch Division of haunt-ch 6mm: Mr. ELEM. Beti'nsda, Maryland mar Mr. 2001:» Sndth: With regard to your letter of Him}: 11. 1966, requesting infomtim cmonming tho fiml report of cupmdimms in Grant momoonuswa and ~0381, plam be notified that the final mporthuboenfilodmdamvisodexpendnd grant nutmdution adjustmt notice received. A copy of the latter is enclosed. In that authorization, the sum of $150.98 to be withdrawn, and the Pomdatim has almady to the wt I trust that this will was requested mtmd this D.H.E.W. earlier this month. clarify yaw hoards. Sincerely yours. Hszmh Encloowe m Fink. Md). Director Win � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Smith, Guerry R. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-234 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/25b9a0bdf5d1f220bed22d9b0ff1a5bf.pdf 17f581381551096edb489d4b88ae1b30 PDF Text Text Munch 22 . 1966 RE: 86—6701 Rel-massv-on. Mr. John W. Rim Assistmt Financial Mutant Officer. Nation). Institutes of Health NIH Bethesda, Huylmd Dar Mr. Finn: in grant I on mat of $7,377.81 Wd thim Enclosed is a check which mpmsents the R01-1‘fk8597-01. in the grant this mwtim mum the files mt that fomdntion. round: wants of this the active Myouvarywdlforyowcmpnmion. Sinmmly yours, Hut ﬁnk, PM). Eméutivu Mmctor Mfajnh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Finn, John W. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-233 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8097034589a14b3b36c32ad5e143824b.pdf 1359891abef2d8af385a5e343fe5531c PDF Text Text March 18. 1966 Mr. Eddn J. Ell Similar, Trans Hamid Ticket Sales Airlines. Inc. 1215 locust Street St. Innis, 115.st 83103 Dear Mr. tbs The Ell: Psychiatric Relaunch Pomdation wishes to camel card which it mw holds in mount Mo. #8703. Mammlymeouﬂism, intlnnmofthe audit Them Mimbmmmdﬁﬁa‘dnbemtmdasmu nqmctud. Cmammly, I would like to request the issuance of air travel plan 0mm on a puma]. basis, with a single and lasing 133M for intonation]. travel and anotlm- with ”Q" privileges. Ancnclosadcmmm mof$37.07 will “703. Wt Sincerely ma, Pink. Md). Emcutivo Dimctor Max HP: kp enclosure hnlmee � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Ell, Edwin J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-232 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/ae1c1054fcb23397a1d6f74a2ea8e6a0.pdf 68c6ef6c19de4255c21063ae4c63eec8 PDF Text Text Hamh 9, 1966 Mr. John W. firm Asia-cant ﬁnancial Harassment Officer, Katina-1 Institutes of math NIH Bethesda, Maryland 2001a mm. Finn: Enclosed is a check in the mpmsenta the f balm of mt at PEI—0724943. $150.99 whieh This leaves one outatmding gram: which is inconpleto. We muld appmcia'te a fimzl statement on this Iii-08597431. bookaofﬂmmdmromambe mtsomtbo'thtm “cm and of our fiscal year. balmd before Thank you for your cooperation. Sincerely yams, mac Fink, Md). Executive Director ‘:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Finn, John W. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-231 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7a4dd7cc07faf3bca84f36324314bbc7.pdf e3c5c0db256f4fe45251ef66746ad0ea PDF Text Text Harm 1. 1966 Division of Coda; 00:9. Mm mun York 10022 mum: 835 Nw York, Now Ouromdnrhb. seam been mlatad. Mam, the Wmhmmctinmthnludingwlm2of leaendus mmyyofVolmZtomlotathism. Stay: CWMWMW. Sinemly your-s, Mnx' Fink, rm. Emmtive Dimatcr fokp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Brunner, Robert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-230 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/43aab16ecb53b379a9dddc8b384fb823.pdf 02f7c4ce2480bfb3af3e7010ce11b1f9 PDF Text Text Pabnmy 23, Mr. John W. Finn Mutant Wt Financial Officer, national Imtitutu of Health Bathsda, Manila!!! 2001“ mm. rim: NIH Ram pment time, the Pay-Maia holds no active wants from the National At the mum 1966 Imﬁtutosoffbalth. $150.98 mmmof in grant mama-02 cannot be offut in the to our orgmization, and should 130 probably paid directly to the Moral Institutes mad: check forwarded offiulth. chiaispmpcr,mwilldoso,pmvidod mpropcroffim‘bomiwmmnmdicam. 31ml)! yams, ﬂax Pink, PhD. Incentive Director � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Finn, John W. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-229 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/26fe5488223a52e15c81dd25a8996f39.pdf 8a079db1a78307cd582e0beb9020c208 PDF Text Text PM Assistant Humanism Offimr, National Institutes of Health W, , 1968 Fim Wu Mr. John W. 9 NIH Maryland 2001:; Dear Mr. ﬁrm: We have monivad the aunt munmmm minced mind Unapondod W Adjustmnt Notice regarding has boonWinn «upland W the mum as‘of January 1, 1985, are to send $150.98 in thn m—ovzns-os- a! a $150.98. MW? this this indium Imofar as this mat of an in we war to mints Simmly yam, Max PM, PM). Executive Dimctcr HER]: by you � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Finn, John W. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-228 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/dffdcabbecbd6125898621f4751a8a8e.pdf 5167e8f92ae1d654381ac2c64f5b066a PDF Text Text January 25, 1966 TIM 730 Third Avenue New York, New York 10017 Gentlemen: I mum appreciate a report on the present sum of accomta mnbemd A1957ss-2 and Pnu771~u which are in w nun. 'mank you very mch. Sinoemly yam. m PM, HOD. Executive Director MF:)cp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: TIAA Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-227 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5dfc4279a7259368a6d8b37aefaa0980.pdf a40340a9f485d987777a097fe0a0b37b PDF Text Text January 1h , 1986 Trans World Airlines , Inc. P. O. Box 1158 Kmsas City, Missouri 6&1“). Gumtlm: m W in the aunt of $65.97 in Mound is a dated November 12 md 29, 1965. paymt of With this payment the indicates a of 81“.”). Of this m, anwant of 3138.70 balm is Novmnber 3, and ticketby a datedwt wound “62:582560 whim was ntumod as mused with the No. paymt wads on The nomad tax pdd an W Mr 1». portion is 12th $5.140 which mpmscmts the No. 015:261:96ﬁ:03h. the tax was Wmﬂuttiekctinemsimnmtdpwas paid for by the thivamity of Missomri. With our last paymt we aubuittod m exemption attrition“ to comr- thiu tax. the maimed payment, dd these adjmtmants, the amount should be in balm“. With Sincerely Max 350nm , Pink, H.D. Banana“: Director MF;kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Trans World Airlines, Inc. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-226 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c8b0b7126bea2aec4e1d7b92a77e1041.pdf c0d937b1c9fc6ef1b53b01a01a082bb2 PDF Text Text Jmuary 1h , 1966 « ,. r , ..— .v ‘.A...v<.,._ u_ . v (w... , q... . u, “aw." . : .17 qunmm WW, u- -; w -. mwllzmv-w' ”’Eu' m“, _, —.. mwr .7, g<.;,g;.r...m.— “.1” ;-—~rvnwl 2'. .mu. Mr. Rabat-t A. lam: Wratiw Salas Tram world Airlines, Inc. 1&2: [out Strut 3t. Innis, 2&8st 63103 Dam Kr. Lama: merymﬂnforpmvidingmwiﬁatho It is indeedahandoome mmaxImmted. Madurofﬂusewimuhidzmrxmbomsokind to pmidn auxin; the past to: years. Sincerely yours, Pink, ”.11. Executive Director Mm: MF:kp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lorenz, Robert A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-225 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/878ce1104524e5361253f0ac9a3254fd.pdf 1ada84323c0119b5064c67e31282cb45 PDF Text Text January 12 , 1966 Mr. H. Hadley Quinn linden Mummy Skinkar Camus St. Innis, Hissouri 63130 8 Dear Mr. Wu: Pallwing tho Molmion of the Board of Directors would you please sign the resolution autemnts and 319mm cards and send than in the enclosed envelope to ﬂu 3mm Bank. Sincerely yours , Fink, H.D. Executive Director Max Hszp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Grimm, H. Hadley Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-224 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f169b7e9484145eab3534cb2414a6dd6.pdf efd3eb0b810569b6a439e766104b6be5 PDF Text Text Jammy S, Mr. Oliver A. G. 2:09 mm Sons, Brakes March 3th Street .. -\:r» ,1 :<‘.....,.v.,v,.v —..—» WWI—WW.“ >ku—vvfrg—v-W 8 St. Lads. Nissan-i Dear Mr. ngenbergi Wan After you'left the mating the Board voted Mr. Director with mmibmty to be the Assistant m1: Iorﬂufinmd‘lmmimofthefmndnﬂm. Win melmesim themmmdthemoluﬂmsumtmlhnfmmmd nquinsambmknmmiutim. muons? Wyoumoeaxainformmﬁbuﬁm tot‘m Foundation. Sincerely NI! PM, yuuxfs .- ”.13. Martha Director ”7.1“ Vw‘wﬂmvmww—mmm 1986 «clam . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Langenberg, Oliver Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-223 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6e50ddd1649a8f13d878174769f301ad.pdf 21dbf99f9bab43585c1d63bb94ef4e16 PDF Text Text April 5, th “him of Clinical Do. Erwin N. 1968 In roam 1m.W10 30me 07110 ﬂutloy, New ' Jersey M WM: Sepmulylmwzdingympmwmtaopiesofmufﬂm meadﬁchmﬂwmmmlﬂicmmrorm WI. mwwuammphicmﬂwofmmim DI”. m.mditisﬂmmnasmwpindmtormtim. mmisammmmrmmmnmwmim “mismgiwymmiduofmofourappnmims. Smofﬁwoﬁmmmmmliermrkdesmﬁbmg fmqwmyanlymmﬂnda mmmmmtforminfmim. As I mtiaxed to you, I an in Newrﬁmlass, mition. I halim if those techﬁqms intemt yam, a trip to St. muis W‘bemaming dewuldbeplamdtoneyouvisitat matimasIvdllbeintrucity. Them]: you tbr mintmst. Sincerely yours, Max Fink. NJ). Professor of Payohiatry 31‘? om Dr. Kim � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Whitman, Erwin N. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-222 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/283302e8987a774867052c10fbb33c36.pdf 18ccf682d2f3181629f59bcbb2e90361 PDF Text Text April 5., 1986 Dr. L. R. Hima of Biolagical Research War 301?“?! La m. me. "’ Nutley, New Jersey 07110 markuﬂinoa: Immufulforﬁmoppommitymdewribeauramdy pmgmtoyou. Immmubwtyofmingmpﬁnts ofmpmaentmrktomamooiate,m-.Eminﬂ.mim, demtthatMvdllaMmtmwithyw. Mmfaryminteﬁat. Sincerely yum, Fink, PM). Professor- of Psychiatry Max Hf‘mp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Hines, L. R. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-221 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/88b4b5536376c91908f70e81152ee886.pdf 3593c8c2451b14f1f39ef58c5f94d9aa PDF Text Text April 6, 1966 Mr. Phillip Sapir Chief, Research Grants Bmch Natimal Institute of mm- Health Bethesda. Huxylmd Dear Mr. Sapim Rom en Sleep and mm” is of with regard to tha mvim of EEG intmst to an, especially would possible for this laboratory to moeiva analysis. it9fbethis publieatim? an additiml mpy the Many NIH Report ”Current ﬂanks. Sincerely yum-'3. m, of Psychiatry meesm Max Mmjmh PM). � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Sapir, Philip Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-220 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/090179a523c1b1f7a4c56afa1a475630.pdf 65290a9cd5dc0cc1b191b3a5bb63b8d7 PDF Text Text April 5. was» We. Am, Ir. J. A. Vallejo illHarm Calla Mid. Spain Dear 103 1966 Mam of Psychiatry m. Haj“: WmﬂmemmmMmrmlpfnlinm Wormwormmnmm. an abstract ”War halyaiaofmefor WWW" hummwforpwticipaﬁminﬁmsmimmmimdby Dru. mmmmmminmdﬁauy. mmuwt”axolimrgic Wafﬂu'rrumntof Dopamine W“ is a free Mania: MWof“mminPsydnplmlow‘-Dimsim“ hamstmtofapmbablcfmofmydisweaimsofﬁn papmbeingpmaenudmlierinﬁnday.‘ Sinaemly yam-s, Max Pink, 24.1). Professor of Psychiatry Waltz: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nejera, Vallejo J. A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-219 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/76c44fc9ffb40386c48681804c33c636.pdf 9f5250f49c29eb2811b71e64e1750651 PDF Text Text 3}; umm ‘ April 6, 1966 m. John 1". Davis International Institute for Biological Hapital de la Saltetriom in 3d. d: 1'Hopita1 Paris 13. M W Mudioal m 21mm and Dr. Davis: and I m plasma Wm, insendinxyoufile mpiesofummpomuhimwahaw momtly completed describing om:- studiea of water Mymoftheeleetmmphdogwn. Meaghan! imam toyoumdmofﬁuatmmmofﬂu Inﬂtitute. W associate, Du. Damid have been intemmd in Imports of yam work that have appeared in sudden]. md biological «tightening. Good 1nd: in your work. We 81mm yom , m Pink, Professor of Psychiatry MOD. :6:th La � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Davis, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-218 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0b364d2a2662a2e351c8e18e7e557951.pdf 016a1dfb045a2f39b23e173d2679486e PDF Text Text + April 6. Dr. Paul win“ 1966 Palm War Veterans Administration Hospital of Research Tom, Kansas Bur Paul: HayltakaﬂdscppomnitytOMyoufor- mammalﬂmm Immwoyedmtinghimmdhismochu, w.IminWhitnm. In View of your intern“. I am taking the liberty of sending you a draft cow of a pmmn’cim whim my awnings and I made before the mount IBM Meal 3mim. min ammsmmmatdlmmmmwmm use. Pmdy, mum have inpmwd sine- own that meant dam. and I believe we have an opmtiml system mimmybeemmperiovtomtducribﬂ. Mmfoz-ymmintomstmdmkimmin introdmingmtom‘. Hines. Simuly yawn. Mix lﬁ‘zjnh Fink, PM). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Feldman, Paul Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-217 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/13af8eeb553c6f509ac49e3852ea121a.pdf 2fb84185a02fb36ef9a18c082f12447b PDF Text Text U. April 6. 1966 Hannah Accounts Stained mimity admit of Maine Stmfom Pale Mind CanterBasalt A1150, California barium: Myoufwyourmtlomr. Implouodto potmdal studi». mm m pupa-d forth. Mariam Paydnloziml Mood/ram md remnants sendyouaoopyofapmmssmmmwovdud This ofﬂaedauwhidxismwbdngmmed. m Wismoamofmmmmw for mmnEMmmesiu. Marmara” I W “I 13 MM. _ w you for your interact. 31ml)! yawn. Mu Fink, PM). Hthwh meotm of Paydxiaty � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Donchin, Emanuel Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-216 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e062c595c248d6f5678b73547b8026e0.pdf 214e4f0b0b898674cde41a5c774de911 PDF Text Text April 5, WW W1 Mia Dorm La Rook World 925 808 15th 1986 Inc. Building Street, RM. Wm, 13.0. 20005 WWEMM: t‘m It a plmum marking with you last WW will was first I have had week and to share with you this is w cmclusions. WW mm. ﬂutiftrnmdatimmpoor.wewillgotclntowiat We: request first class (not delxm) in auggeetim I unwilling taxable mywr associati's emdpaythediffamm. mmmlimmgommﬁnmafmﬂomandwﬂlpm toleweﬁmemetingsbeﬁothirwd. Wewouldlﬂcetobein Pbmﬂmemixxgofmmdny,mmu.takingme?axisto Pbmflishtmmmdaymim. Gimadnimlwmldmfer mmmmgm. UnwandlikamlmﬁewYorkmmyemm,Mgust2, tomwdttudayofhugusthini’aﬂs. smmmmgm 7 iammlym,wouldyoumforaemdatianintm night, August 3. Winniformday Hamldlikemgofmmlbsmtomningmdbythamimmt mmmmaynight.mgust8. 103mm. Wemﬂdlikanmtiaminwningmd,mst9, from Moscwto 12, Oak-May. August mmﬂdlihemowations 'lbdoso,mwineitharhvetogetbacktomcowlate mundaynight,mlnssyoucmmxgemmlymmingﬂight The Vienna. fmlaningmdmrbwwmnwinmmiamctim. Wimﬁmma-Istmmlsmuldalsobemtarl‘riday WﬁdwmsrmldmstopominAmmmm moﬁgimlplmforamgxtfmmmmmﬁcismafﬂmed. �Miss Emma Ln Rock April 5. 1966 4-2- of them W‘tsmwillnead forfmmmdthehotelmmdamsmumhetmmm.m Mnbeddedandomdwblnbeddad. For each , I thinkthisansmmtmqmsﬂms. assistance. Wyouforyaw Sincerely yours , Max Fink, Wm PM). measoor of � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Sanders World Travel Inc., Donna La Rock Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-215 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/2920e35c42eb69978b0eedbaae061138.pdf 7851b4f7d3ba9ddd4a58e94af5bc49e4 PDF Text Text April Dr. Joel J. 5, 1966 Elkes Professor of Paymiatry Jot-13 Hopkins School of Hadicine Baltimm, Dear Joel, mm Implemdmwxdyouadmftmpyofwmpon mommy, which will be Chums-{c Mpew 95 (30an: mating ofﬁmmwz‘icm Psydxiatric tedatmfom Associa‘tim. Immatmmqmstofﬂmmummﬁee Mlookfomrdmyowcﬂtiqm. ButycumstmﬂmtI myhmweditittocmfmmmemlimitaﬁamofﬁn myxaaymtxenjayedhavinglmwithyoumdwmt totlnnkyouforymmmykindcmntsmgardingtha oppor'tmitieainmw‘lork. Mybestmgat'ds. Sincerely ma , I'M). m, Professor of Psycrd/atry Hm: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Elkes, Joel J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-214 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/56f7bdf2f827e744de970347fdcd4477.pdf d4f820922f0b764b26d776ebb26a7ee6 PDF Text Text April 5, 1966 Km DP. Nathan 8. 19 East 88th Stmot New York, New York Dam Nata: I vezymchanjoyedourdimsim inWaehingtm. and shmldliketotenyouthatlam, indeed. interested in' cmﬁndngourdismsm. IwillbeinNewYoxicma mm definite basis in May, and will take the libwty of Myanatmttim. Sinmmly yams, 11de Fink, NJ). m Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Kline, Nathan S. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-213 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d21d6d0a57afabc021944eee382eafee.pdf f21b7ee282b3a50154e37309017c40f0 PDF Text Text April 5. 1966 W. Jchn F. Harm Associm radical Dinetor Squibb Institute for Medical Ream}: m New new Jamey oasaa Wok. mm. Hmmez MahipmntsofﬂWMmmaimdmm. agohawnwbomputtomidwablem. Mmlspatimta mivinxthismdimtim.mdwmmmmindammtm pramt sypply will be daploted in thm m.airmail Rather than try- to mamas slumping at rates, wmnldyoukindlymdusminyaddiﬁmd lemmitaof Pmlizdn Diamante. lot no. At. 1-53/15-34. Many themes. Sinoemly youm, Fink, PM). Professor 9f Psychiatry Han 24?:ij . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-212 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e515fecd1eea92fe0613dbf2187f9a42.pdf a88b79f4f867eacbb5ffa77444aa4bb1 PDF Text Text April 5, 1966 Tue Willim Alansm White 20 West mm Stmet New York, Haw York Institum Dear Stan: Iwanttowritc to apologize forthemmmoasin I had been trying very hard for a number of my men to discuss am important details Haahingtcm. :3an be possible that it might mad hodosothatovcning. Ihadtolnmuptohimmther inﬂatedtoinviteotMramdtMbemaeocial evening of it. or to use the Opportunity may from his to discuss the actml working auditions. appointmnt and we haé telepmm 1mm mxiwsﬁmtyougattomhimbetter andmuldlikatoamnaeauohmopmwdtymwnlam inﬂux-chm. I‘mmtsonyifmybehaviormdtobo mnbutldidvomemttohawthiaopportmity to msolvc some of my questions mgwding our working togcthar. IwﬂlboinNewYoxkthemokoprdllBthmxd will call you at that time. Please accept my apologies. Sinoemly yams. Fink, m Professor of Paydaiatry 24.13. Mfz‘juh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Feldstein, Stanley Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-211 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/155cb52401ef58bd4d1cb9c83f801f11.pdf 844e8dbbcd054127ae1a3b0a4c033d1c PDF Text Text April 5. Dr. 19 more. SW Strut East 88th New York, 1966 New York mm: Phyltmthisoppwtmitytothmkymform fmkdimuim. Itmmstlnlpfulmhugiwnm mmhtopmdor. I look form to taking an opportmity to visit youﬁmImMianodc. Again. my thanks. Sinocmly yours. MI}: Hrzjm F119“ Md). Profaasor of Psymiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Simpson, George Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-210 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4be0028d9ae15adf7b697b16dd13d163.pdf 97691a20d5be2ce1c54f22e23722323f PDF Text Text April 5. 1966 Dr. K.“ Lifebitz Research Facility W Wm, Sum Pbopital Now York Dearxem Mmmywhfortmaumipﬁmofwmlim onlibntw. Ifmuditmﬂﬂnpiatmam Mmimimtod,ﬂmmmlimmdoumt Mom Mtitsnlecatimntthomdofmaigul. studiosmmwmminsmll,lumﬂdmﬂnvmtmdify , helpful. mmmﬂmtnwamdforawrmhmlm. Imuymmjemmmtiminmgtmu Ifmdﬂummtstimuthg,mdm muldid. minuunﬂmdcdofﬂwtmitfmsofmyofm study wow m in progress in Europe. My hast NEW. Sincerely yours, Max mam Fink, H.D. Psymiatxy meuaor of � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lifshitz, Ken Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-209 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b79b287ee7ab455ddef3a24290be67de.pdf 543c8ab5e3f0307a324be29dc66a91ce PDF Text Text April 5, 1966 Sabine Em of meuaor Psychiatry Dr. Lhivemity of Minnesota W113, mm MM, Immofulforﬂuopportmitytodinmswpmm It giwsmyutplmmtoundyoumpieaofﬂmemporm which which the extent may have bun muted ofowmmﬂziapmgrm. animatiaammhicmview 'IhoIm “ﬂmmmmimlpmmformrmlym. Symoaim mm tells of m of the applicatima. I». Itil's mvicwofdolizdmshawaﬂuuaetomiohfmqmncymdyur nthawhaenputinmmamdypmm. "mmwnuxhymnphmmlog"withyouinﬂuhingtm. mm Ihopeﬁmtmmlesmrnlpful. Sinoanly Hm: yam, Fink. H.D. Professor of Psychiatry 1mm; enclosures � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Schiele, Burtrum Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-208 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0d0359a43c1335e13865354791e40324.pdf a0bc30e4da60fb19dbadea7a19afe48c PDF Text Text April 5, Mr. Robert 1966 601% Vice President. Research Nyem Labomtories. Inc. Boulevm Island City. New York 3u~2u Vomm Long 11106 Dear Mr. Qaldmm: Wyoufwwurmoent letter. Omstudyprom moontinuinghmmthwmn, dehavealmdymdo to establish a testing; laboratory in York. mamts aotabliahumt of this laboratory will take a New However, the: umber of study mtha. In the mmtime, we may be able to undertake a specific prom of intamat on you during tho sum:- son-tho. Would you «scribe the problem that you how for us? Iplantobeinﬂaw’fommringﬂwmkofhpﬂl imam! I cum momma if a description of your project before then, Idlidismsitwithmyassooiatostybeubletopmmt a definitive proposal at ﬂat tire. Thank you for your inmmst. Sincerely ywm. ﬂax Fink, ijmh £1.13. Professor of Pay-Quarry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Goldman, Robert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-207 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/dbbc932a17ba17c00acae3de43d49f4c.pdf 9de24dc10f5604e0ec290c6b7708364d PDF Text Text April 12'. J. J. IV World 1966 Ibor, Moment Games af Psychiatry San Carla Wm 106 Am, Fwdtad Calla Lopez I. Madrid. Spain M 1’1". 1330?: I inﬂation to discuss Wally W mmmmtmiwmmsmmormmt “New am pleased to accept your kind in Psydnphamloy.“ I pleased am leWmmmmmmmmemSesaim. Iwmlimitwmrkatolsmmsasimﬂcatedinyour I look forward to tha We. Sincerely yours. Bax Fink, 24.13. me‘asaor of Psydﬂntzy � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Ibor, J.J. Lopez Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-206 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/57a6ff2a948d3e9a768b373a029295db.pdf faca506f9dc65866d5081e77928f48a8 PDF Text Text April it, 1966 m. Alfred New York New York, H. W Meal college Fifth Amua at 106th Street New York 10029 DearAl, Afterywleft,m.mld0vammoanedmandcamto mymomatll:00p.m. Wesatmddisemsedhispmmmtil befomtm 2:00a.m.m1feltﬂmt1hadmgetmmst smimmﬂmday. I Whimaself aasmdandoompetmt Hamvinwdhisstudiesmllmdgavemacloarpicm m. ofamtinportantmaaamhpmgxm. 'me mly diffiml‘ty in micatim appeared to Mate to hispmwﬂpmmmﬂhisemmlmls. Whehasspent mtﬁmwithputimtsmdmuldlﬂmtomnﬁnminmtigaﬁms amarienoatocbﬂﬁsmdmuldliketheopportmitymlm. in patimt populations, he indicates that he has inmfficient Iietaoldmhemsoffemdmogportmity tomrkwithcmrlie Shagass, butstatodtnwouldpmfepmininginﬁewmxk. kgiwstm mama imam alsoakmsamdandadeaimmdavelopapmgmaepamtefm myprojectleacm. misbemclmmraspdceofmtmtming towerkuithkoy,ﬁmlmfeltma"tigxt"smp. of desiring to in m arr-going program but Idesmihadmymsmdypmmbutmenlhadtomclaw that itmtndtakabetmnaixmnthsmdayearwangoptindsﬁc) befmmoouldmasmblyhawmequipmntmthepemml mamtoomtinuewstmias,mmdicatedﬁmthemededa positimmwandltoldhimthatImuldmlayﬁwfollowingtoyou. Ifmmpmgmminpmmss,mmdbeavalmbleasaocim. especially because om could assign general qmstiona to him with the optimim that m might a resolution with the flair mush Plowmamlasshemuld ﬁmtlwhasatminhiaearliersuﬁies. MamnimshipdthFOyIdomtthmkthatmmasmmblym available for such studies the aquipmt, or pommnel . If Immmdyouholiewﬁwtmmmfmdsmaquipmr labamtuy,ﬁmn1mﬂ.dsuggestyouspeaxmiouslyabmthaving space, himjointhestaff. mmopizﬁmistm'thiaapplimtionis 18~2Hmthstooear1yforﬁwmsmdthedxugaddictimpmm. �Dr. Alfred M. Madam -2- April a, 1966 If, however, you would like to have him participate in the and if independmt ﬁnding might be forthcoming studios mmry for that program, than we should be able to discuss this with him. I raised the question and his was that he was mm interested in alectmphysiologioal methods than in mummy function stmias at this point. mat I loftthesuggestionwithhimﬂnthewastogetintouoh withycu, orywwithhimwimintranaxt twwaeka. Iwould also like to say ﬂat "I would like to confirm my inpression both with RoyandHagarBridgerifyoumuldliketogoa‘madwithan I do mt want to call Hagar unltss you are atmgly inflmncad to nuke and! a oomdtmnt and if you an cmsidering it, I heliavo we swim discuss Dr. Overtm'a oollahoretive abilities appointment. with Roy and Hagar. Sincerely yours , Pink, MD. Professor of Psychiatry Max MF:kp P.S. He did tell an that Dr. Rosmhamn had just 00:10le a contract with Alan Miller for research space at Bronx State Hospital, ’a control. He traught this was pmaunably moor « basic science space and not patient care areas! -e � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freeman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-205 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0466271155d8c9bf1c694a44cefc5288.pdf 1d7ebcf9338f02af2f01d207809cb25b PDF Text Text Apml '4 , 1966 Mar Br. Katy A. B. Brain Research Institute adversity of Califm'nia Medical Center [as Angeles, California 9022“ Dear Mollie, Ihadﬁmplmmoflmdﬁngonl‘ridaywithbr.J.Rmrqm, with him of Elsevier. and :3in the possible publication of tinteemicalmualenelosedmmith. keuggsetadthat! memawpyaadindieatedthathemuldmymmepinim ammmmmldmimmmdmkmofmefthia mm. Be ﬁxdieated material in your pmposed international tlntynumplamingtomdngup—to—dateﬂmmﬂndeof miter Marcia of EEG as described in your EEG eupplmnt . Imalmemlosﬁngampyofamportpmentedatﬂn Imsmimmmr,mmmofthaappﬁea— tieminmatwdatail ItistmappHeadmtopeyW u ' reclaim that intanstusandommsmt studies mdefinidwmwltsﬁmmminemdedintmt ‘ Simmly yams, Fink, Md). m mecaaer of Psydxiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Brazier, Mary A. B. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-204 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c27c76e6b5862fcf864e1a2fd54f7c0e.pdf fe6f8105859614445ab04f6b634e4264 PDF Text Text April Dr. as, 1966 J. marque Elsevier Publishing (Downy Mean 52 vmmﬂt Awnm 213w York, New Ym'k 10017 Dewar. Emma: First,1etmtalmthisoppommitytoﬂmnkyoufaramost humming visit and a deliciow lunch. I have sent the material mm.8minraayousmgasted,andacubmofmyletteris leooed. . Imumhadﬂeappmitytthoﬁdlimedley. Itoldhimofﬂzeoptimismuithmmwumtmmpmpomlsm publish the smoaiwn Md indicated that any of the mm we dincusmdmldheameablemm. Ialnomokﬂmlibartyoftauinghimofowconwmaﬁm regarding the list of em‘xom oanRumcﬁ. Iwouldbe mammapatamsmhammmwmuldbeplmedﬂ Mdeppwtthmsﬁmyoumimd. sinmleavingyou,Ihavethchofﬂmmedformm for E38 analysis. definitiva wblimtims concerning mutterDr.new Brazier‘s review, I are: of sufficient mritﬂutlmuldlﬂcembﬁngthismurialmgeﬂwrdwingﬁn nextfew mmtm mdpmmt it'towuagain formoonsidmtion mm Iwculdbe pleaseduo mtrﬂmte to Indium the applicatima to While Witwasmwmmammemmapplicabh. Againwthmﬁc‘sforyouvmurtesy. I'lookfozwardtowotking withyou. Sincerely Hm: Pitt, ms , PM). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Remarque, J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-203 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f383ea92ce3530ffbf4410922d496afe.pdf 7e918fbfdf681d6724a4fe1f8a594499 PDF Text Text April u, 1988 Instrument Gummy We 161 01:! (tom AW Quimy, Mantra Guam: Sapamtely m 3111ng you me 03011105111311, Modal BA, from cur doctmemsﬁulomph. Serial No. 633135,m Thawiteoutwithﬂnenclomdomﬂlomhasamm time delay which leaks like time m. a prolonged mutant. mathsthemlmd oscillagmph with a lawn good unit _ Hmm youpleasa either apiece or main this mit? mummmammuuwmmotmm,m mdlliumttnappmpmiatompdrurdamwknnymaend ustheahargas. 811ml)! yours, m Pink, 24.1). Profuse}? of Wm � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Grass Instrument Company Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-202 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f39059d3d1cb6167286bcbff6f149e35.pdf 69c722f9a5abeaa893b13d578f4dadda PDF Text Text March 29. 1966 m. Stanley Feldstain 'ma William Almam White 20 West 7%!) New York, Street New Institute York Dear Stan:- Wisdoopyofﬁulsnmvimwhimhm 1 hope moonﬂy been completed in our laboratory. will‘bu helpful to you. My best regards. Sincerely it yam , Fink. H. m meeaaor of Psychiatry De :4?sz Mature � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Feldstein, Stanley Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-3-200 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6f8f7d3366ee3f4ddb3be20f32d7864d.pdf 80c175172f35007698ff7c78cb38f292 PDF Text Text March 25 , 1966 Wu, Jr., Manchu Director Vimnt Y. I‘LD. mum-low t of Clinical Cowman, Inca. ‘ m, Went Om. Pfizer 8 053m Dear Vince: Myouwrymwhforﬂwmportsmmmimm. mmmwmnpletingcwfiﬁunﬁ: subject. mdassom aswohavaasatisfwbowtmatmtpenlod,1winamim mobaemtions. Smly,bymyoulcmtmtﬁndosagas mtnvomdhawbomtaohigh. ﬁbhawmededymm mm,mrmuutatmmmm mmdfmemdmwmmmmm Allofmmpatimtahndmedor‘ages W. in form walmwmmtendpmcyelidim. additim, and, mdumd, mot-ave developed patkinsmim, mmmmmamumthacunicallabomtmy mtﬂutthismportwnlbemlemdbyﬂnendof my. datambeingmmdmdmacmtinuixxgbnimmdl Wiﬁzmgardtomaawde~5227,Iaymﬁutthia isofmidamblaintomst. Imﬂdlﬂcemmmmsum MIminmitim,Icmmtmakeaspeeﬂic mimmmtwindomy‘bestmmgeaumaam astudy. demwmmmk. My best regards. 81ml)! yours. Max szmh Pink, PM). measaor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cremata Jr., Vincent Y. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-3-198 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8d9dda5404a30a77a0b52cfa1e8de406.pdf 7a9a441c018f2ca0a37e2bed412a4339 PDF Text Text March 25, 1966 Rama E. W, H.115. mmctor ﬂiviaion of Mtibiotic Acting Drugs Department of Health, Education, and Welfm Washingtm, 13.6 W I». W: is a Xeromd mpy of the literature review by Dr. Simm. dated July. 1965. and a list of the eitatims smich pmvidcd the Main for our intranet in thin amrimmt. Enclosed Inthemigiml pmpoul,mhadplarmdtomcplom We the effects of the Wamtim of tryptophan. ham mtasyetmdamakenthispmoftheetudy,anddomt plmtodom. Sitmrely yam, ' m Fink, Professor of Psychiatry M¢ Du ' HF: 5m}: Enclmm � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Barzilai, Raymond E. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-3-197 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9e8593eaada3c17ff9fb7fb31eba5a36.pdf efbf31af46394148a7779bca602ca09d PDF Text Text Mach 23, 1986 908 9:. '3 Elm Slim lab. Div. Olive Louis, Attentim: Dear mm Mn. 6'31m Stigmyer' 311*: Please adjust imoim No. 377% and mmhmit: 6‘5 x 7 prints mt included 9.5 x 7 print: cm km on. sat pﬂntsamfmmme Wgatiw duplicated. sas x 7 sat Thank you. Sirmmly yours, Max Pixie, Md). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Harper's Erker Slide Lab. Div. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-3-196 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/24a84ec992173ccc5e311612e899c3dc.pdf 6a7069a80d0bf3a404facc9eb1ca599f PDF Text Text pm 23. 1986 Sim 21. Chaim, Healer. 24.13. Waco on ma mutt» The Madam of Psychoanalysis 125 Exist 55th New York, New Yak 10021 8% Dear Dr. Raglan meat!» fwam of the hammer W farmlopportmityto mammalian coordinated affomo. Putnam tbs fallouing juin in any Wyomifwyominvitation the Newsletter. more am inSt. fa»: puma]. note my be of interest. Fink has been appointed m 990me of Psychiatry in the Dr. Dew-tum of Psychiatry at the York Midi“). College in June. New Dr. Fink has been the {bat Director of the Himm'i Institute of Psydmiatry and Research memm at Washington mimity since 1962. You my also wish to not: the mntinuaticm of our studies of LSD with m. Jaffe. collaborative We Institute. :m for a smsaful armiwmary issue. Fountain and Dnhlborg of the William Manson White Beat smartly ywrs, Wajmh Fm. Mob. m meamr of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Nagler, Simon H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-3-195 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/38d02ab1426189b8f3880d9f474111df.pdf 551b00a4df3b9e9a5bf1e313135549b0 PDF Text Text Mabel-2 . Ipuise 22. 1966 G. Thomson. Finn. Executive Semtaxy Guild Health and Human Dawlepmt Cmmittee Pmym Divisim of Rascamh Grmts National Institutes of Health iject Beﬂmsda, mm 2001:: Dear Dr. “momma: Inmldbepleaﬁedtotakepminmmntappncadm site visit on at Me Ibivemity. for ymr invitation. April 20-22. Thank you .1966, Sincerely yours. N Pink. Professor of Psychiatry M. D. MFQ’M': � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Thomson, Louise G. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-3-194 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence