22 100 6561 http://exhibits.library.stonybrook.edu/mfp/files/original/b5432c324330be9d4091d9c8bd0d8ef2.pdf 7f789aafb61de323d5e0bf526cb89a8a PDF Text Text April 7, 1966 lands 8. Stuart, Pmsidmt Pomdnticn Psycmatric 22 Fair Oaks Mr. Rum m» 2“, Missouri Baum, Asyoum. Immmmbyminvitatim tojoinﬁnfmltyattMNwYorkMioal Colleges: meeaawafhychintry, andwilldo soattheandof in I m, thumfom, We latter of animation Emmtive tho want submitting this War. yum June. effective Jun 30. 1986. as Insofaraslwillbeinmitimdxmingmmxt fewmnm, itmuldbeofmistmmmm‘kof the Pmdm if a mu Hammad“: Director were animated 1:11: responsibilities for the at this noting to —- um Pamdatim's affairs on or about April 15, 1986. mylmmhomitytoﬁmkymmdm umberoftrnhouwdformirloyaltymdstxpportdtming “charm. mumyou. Ithasboenaplmmmdmhomr . Shmly yours, Max Fink, M.D. Exam-the Dimctor � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Stuart, Lewis B. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-235 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3cd4ef6b384e0a7a2220fe794621fe09.pdf 4b230accaa76b8855ac2464a8277edfc PDF Text Text April 7, 1966 ths m. Hilary Demon, Editor Scierm Books: A Quaruerly Review Avenue 20005 D.C. Washington, 1515 Door Mr. Benson: Imuldheplaased’oopmicipatointhemviwof in medical sciences md psychology, as mqmsted in the must issue of the bulletin. Good luck in your raw madam-admire bodes mm. Stately yams. Max rm, Mm. Professor of Psychiatry Mfzkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Deason, Hilary Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-236 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3dda7ec3aac30a30700c066763cc7cb0.pdf 7a59530989e2870d0e273273ebe2047e PDF Text Text April 7. m.m.inosm Chaim. 660 S. Department 1966 of Psychiatry mimity 801ml of Pbdicine St. wuisigmssmmi harm.lbbim: Asymhm.1hsvnbmhmomdbyminvitatimto join 13m tawny at tbs M Yes-k Medical college.” memorofPsyeMatry,mdwmdssostﬁwendofthe Imtsking thisopportmity effective Jme 38, 1968. mt of Psychistry.W»mmmmzmmmmpm~ ﬁrmly my, w Max Fink, run. Professor of Psyduiatty ocznamH.Konthing � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Robins, Eli Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-237 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3fcb972e3d54e973c4879b786f6d3b55.pdf 160826c469b23da266b2b784c9a18273 PDF Text Text April 7, Dr. Eugene Luke: 01mm, Ompum W W, Research Facility 1966 Wt State Ebspital New York Dam Gem, maimed is a copy of the abstract which Don and I have: submitted to the Warm of Psychiatry. I would appreciate cumin-ac at the World your notifying the appropriate Was ﬁntmnismmﬁmforﬁnmmim, We auditwwldbo appmpriateifhemaoliatedintmpmgm. We will prepare a final museript diving the next few weeks Mtrytomtthemtlatdudljm. Immtsmaato'me mammdmtimmdmldapmciammmmm m. V Ifldomtmmyw. Iwillaasumethatitis appmdmataly 20 minutes in length. Again, my thanks format-kind invitation. Sincerely yams , Max Fink. 14.5. MW of Psydliatzy � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Laska, Eugene Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-239 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/71832a146aad332a01099bfe8de59534.pdf 2589c79bbc5d32b904f30f489f78b4c1 PDF Text Text April 7, 1966 amt! We: M Dr. Ivan P. The Lilly Research Eli Lilly and RR 18, Box 285 Indianapolis, Indiana [has Ivan, Iwrymchenjoyadmlmminmshingtm,mdwhile mm Idonottmnkmtfurmrsmdmuichloseﬁmssa its possibls mmpeutic agent in m mud. Wemnow masamnuslstimlantstﬂlimﬂgmsus. collatingmdatacfmmsmdymdfindtmtwmm I mariting to ask you" clarification. omfussd in one regard. mums; to the Physicians miﬂmrmnmrmbm. is listed as Massimo-3» _ 91M; Win ‘mimdwithiaadszid madman, i . We 5.3 had intmpmted the mismmimnmas indicatingthat itwasthu 2)me m-mieleswittenhyeaorgom MappemdinSemmycin. also list his use of D form. In our dismissim, I believe you the ﬁxture. Dbefam indisated that Sammycin is Canyouclsﬂfymichfommhwebeenming? A150,]: mmsplmdﬁmpmdmtdesmiptimmdmuld mquestymr sendingms Wrifiﬂ: is wailable. Myﬁwrks. Sincemly yams , Max Pink, 1-1.1). Professor 0! Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Bennett, Ivan F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-240 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a22adf4b5c61efe6408091ad4eaa8f27.pdf db39c5b7d170871525e5b2cb8aa069aa PDF Text Text Apm 7, 1966 Dr. Jules Angst mm Mob Paydtimiscm miwmita‘tsklinik Zurich 8008 31 Switzerland withyoudwingtmaiwmtm party Ihavnmvimdmofthe «Magaimwmotth' .-+~“='Sclm1d11nlcftw1thm. Imtaking mum-tycfccndingymocpicsofﬁupmmﬂngacahm mllaaamtmimmpmmmdatﬂuﬂﬂywhichindicates ' - mwcysinwhichwammingmissoale Inadditim,1mmingymaccpycfampor¢w1tmna fmyomagodacmdbingmomﬂomwwimfactormalysis “WWWIWmmmdobcmrwﬁhcﬂnrmchniqms. IMmmomisawwimtaumeouldbc plemdmusistyouinmywayﬂmtmcm. @ood lmk. Sincerely yours. Fink, PM). Professor of Psychiatry Max HPﬁcp Wale Wm, cc: Dr. T. P. 8. Watts @3133! P. 0. Bow: 333 New: York 10702 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Angst, Jules Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-241 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/da8e5e5f7ca4f422da237f86faf3485e.pdf f603adc3857e736b25ff628d19ab1cc1 PDF Text Text April 7, 1966 Dr. P. Scimidlin 010 J. R. 8. A. My mm Wﬂmls 8:310 #080 21 Switmlmad W: ut‘mtmwhmamiwmﬂmkwummmfw at: Dear Dr. sit/$1M}: mmimitnimtowﬂcipatemmeeiymm mmmmtm.1fmmmsimwinmting meﬁmmlyplwdmmmpmmewhichmm pleasinymu'pmminEum. ”Imm,wmpmiwlerlyinmemmme dew/elegant 0f rating scales. I am enclosing mmlmm empyofmmpmmtmﬁngmmmnstofdeﬁnitims Mmhemfwﬂlmlpful Atthepmmttim,wem Meweeothetitemhetmlatedbymoptiml mmmwwdmmmmwm Wmofmgmmmwm. AeIindioated.Weewciete,mnmItilandIm metinmminmmdewlomtofmpmm endwinhywtmbeatoflmc. _ 311mm yours, Pink. Md). Profeaaor of Psychiatry 1%): Mthp on: m. T. P. 8. Watts � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Schmidlin Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-242 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/217a82501368952124c104a3b4692b9b.pdf 69adc79b3b254d3cd9bb29e004bc0833 PDF Text Text April 11, 1956 m. T. P. 8. watts Guy Rwandan 1330 P. O. Box mm, New York 10702 ‘MPaddy, Latmﬁmkyoumagainfor-ymmkindmssforinviﬁng mtopu-tieipminthodismliamofmﬁngmatmcm matings. I onjoyod the dismim and the subseqmnt meetings mam. leIhawsmtyouoopiesoflemmﬁutI hawwrittanmm.mgstmd8dmidlin. Implmedmmlmampyoprmpmedpmmaolfw thialwahatimofsr-lss. Wavinmdertakeﬂnpmlimim inmﬁaatimthismkmdshouldmmdatawithinﬂnmth. Imﬂdbamtafulforymmariticimmd suggestions. Sincerely yours. Max PM mm, mm Professor of ‘ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Watts, T. P. S. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-243 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d47a64bb66b0d69431b1974ab328df25.pdf 352f0950353fc4453a633182d932fad0 PDF Text Text April 11, 1966 _ W W (binge Fifth Am at Strut New 11'. “n York Radical New Yam, New 106th York 10029 MAI. Iumtﬁmtymmmtingswithﬂlﬁllermmwn. metmkmMchmmmmdiﬁMfm inwatigaﬁ‘pne with cyolamcim. 'Iho Watims am still misunt'deamquimplmdwiththestMyaofw. We mmmMHimmomdsm,mtofWiats. Iwiuﬂyinmﬂcwfokammingmdwinm Asymmystillbein tomtxwonmmmﬂaymg. CalifomiA,Iwwldhamfulifyouwou1d1eavemmml WMMMmMthmmwgemm Mdaywmauy. 31m Aslmtiaud,1hwebminvimdmpmicipataintha April 21mm. visitatﬁﬂmmmdaymdrriday, the festivities with Dr. Bleultar. miswillmuimmmmiaa Immtlmybeemed. Ifwaoelmtitismm valmbhfwutobeatﬁnmmcomgeatmtim,I wﬂlmlaintom. . $5le your: . Nam Fink, NJ). meessm of Psychiatry Wzkp P.S. WyouwouldlikotostopbymymmwaytoCaIifomia. Iwillbo availableaumkmtil Friday evening. 1mm! beplemdmsrmywaboutﬁxehbomtoriwhm. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-244 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6ce34db42e2887fabebfd439e814d454.pdf b6637bedb04677953f19e655b36db1a8 PDF Text Text April 11. Dr. 0. Jmﬁm Bank Natiaml 8967 1966 Cole Building Arlimtm Road Bahama, Maryland 2001a Dear Jonathan. RE: ”141380-02 Mammpriam ofﬁcialsofﬁnlhimityofﬁissmm, Eula have approved my mqmat to participam mum» of Payclmlomr, Augusta—11, in inﬁnlnumimal commas Moon. of January 7. maybesufficiant, I includﬂxg Wth maummﬂymmdmummﬂdamwpyofm umlauﬁmizatimorhxdicauinmoﬁmwhtewaythe appmvalfortlnexpmditm ofﬁnsefmdsfmm—IIBBO. My thanks. Sincerely yours, Max Pink, 14.)). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-245 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/566b20500ad02d02a477394469c7af58.pdf ba92d5bdb37d4fe15d8d28d6b5553acc PDF Text Text April 12, 1966 Mr. Robert L. Robinson Public Infomticn Officer Mexican Psychiatric Associatim 1700 Eighteenth street. NR. Hashingtm, D.C. 28009 Dearﬂr. Remnant: Thank you for the apportmity of editing the discussim of membrane. Ihnwmtmdmmeofmymmkem The suggested are the W, I hope. style. inserted on page four, discussion 2. mime Sincerely yams, Max Fink, 21.13. Professor of. Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Robinson, Robert L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-246 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a0196a6a04b986b15342d51b9c388317.pdf 05b4b3d61d628f450cdba4110f5b5426 PDF Text Text April Dr. Film: More}, Gummy 1’8me 001103 Wm Pall, 16.3mm St.‘ 12 , 1966 Editor 55101 Dear Dr. Sanford: Zubin, mmmmmumtmmmmmMmd volume. "Psydwpaﬂnloy of WM.” I failed to moaivu thn .WhanImmimdﬁnmm.ttmmclmedmviewwaswittenin ﬁnhopeﬂutitwinmtwimmappml. Immmwhmmlm.mtdidmtenjoyitm1f asunhastiﬁsmkwhmﬁﬁsmviewwaswrittem makingthe W“ofavolm,wmldymfmmwithamitiaimof Wamviw? mmmdmmmdmﬂmammimrmmd. Sinmlminmitim,Masmmvimmaythmfom Jm.1mu1dappmaimmrctmtomymwpoaiﬁm,ifmy ashofwaarofpsydaiatxy,Nw_York mica Wham, 0911.53,):«Yonk. Myanfarﬁnoppmmitymmadthisvolmmdpeﬂmps, mmmmmm. Sinamly your-a, HEX Pink? H.13- Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Sanford, Fillmore Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-247 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/cbea38be81b0679447f131696c4eb602.pdf 03780fce7513d6e74c6ff4b54b06e77b PDF Text Text mm 12, 1966 Mam W Chum Miami Institute of Mr. Assistant A. sues Arum). Street St. Louis, mm Psychiatry 811.39 mm, Wmmmwlmmtimmqmmmmmd inmmblodimsimofkpriln. Itmwmmmngofmmmmﬁutymmm unmitymammmtmormmmmnasom. mmmwm mumwmae. MWbom. “mema0,mw.ﬂitiatobnmlem,haw mumm. WWW.IWWtMyoumviwﬁm «mmammtmxmﬁmmwmm mdmvidufammmlymiﬁmfwmminderof the wt. effect“: m 30. Shandy Fink, yours, A mm of may Max 14.13. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Thompson, Warren A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-248 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/13a09a9f228378e701e0e1a6c38d45f8.pdf 28fcf33ce891a0c8cbf6c3ff3eaed227 PDF Text Text : lope: It. IV World April 12, 1966 Ibor, Presidant Congress of Psychiatry Calla Mocha, 106 rum-1d 12, Spain M m.» m: Idid smdyou abstracts as mqunated by Dr. Vallejo Najera. thusWIWtﬂnmmbempmblam, If the rules of the amtdbutim as magmas limit participatim. I beliave official discussant and in the Roma Table will probably be of greater intervst both to me and the audience, than the open micatim, which I hereby withdxw. my My an best wishes for a successful (bumss. Sincerely yours. m; of Psychiatry meassor MEX Hfzkp Hon. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Ibor, Lopez Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-249 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e48705a8e87250026c65807ba823d434.pdf 333252bd01b86f4fca479b5b654e9423 PDF Text Text April. 15, 1966 w.h~iatideH.Eem www.mummWMMRII Neal'ork W. mmmz V memmmmmeum feasibilityortha queatifloatimofmectivetimm iamirmm om. ﬁewmmcfmmwwﬁchmmw ulthWhtW“md”ems,“whimmims midnxtﬂmdasstetesof“activctim“cmbemumd misled a setisfeotcry minim} is eeteblisted. men is a we: deal of evidence that the rapidly mdmttmrelatmnshipeamverytmamins We see: sample ammo in behavior as mtel axittmetic both simple cf twin am couples fisums, mention to visml or auditoty Missal. etc... and «melee. perceptim mess swine vorjwreism 3.9%?) and (Wt cf the train). fer my years have been nestled out and are Iwmldnugsentywseemvinws bylaw Lindeley in 196.1 (Elmer’s book on atimletim Wetevemintemntcdinmspmblemfmthepomtof mwmmememmmmoreemm. mmmmmmmymmm W133 ‘- mmmmmmmmmymmm byattmﬁmwatterﬁcw. Immfidmtmatmymcte ofecalpmmruedelectricaleotiviwmrelatedtottetacm ”mememmw ﬁrmly we, m, of Psychiatry Manor Nu on: m.Hatth.Klim 14.13. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Esser, Aristide H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-251 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/47c93caf44bd4e83dc90ce922b4e63ae.pdf 1cbfe65f3f7543db393d28af5bbd299b PDF Text Text - April 15, 1966 Mr, Nmeeymsas max-mm: Wediseetetmtfmm.mwminmmrt WM ImWMMoﬁWeMmdﬁn «$371.00 fwﬁnMMymsMMswliedinm fimtmportofﬂwmsultsofthiao‘mdy Mammwlms thmwmmuthemmmbeammm WWWMMMﬂm.mﬁwpmmdmgs Incidentally. Iméd-wiﬁxmdisma the report cumming ﬁnuiﬂxmlofywmmm. ammmmmmammmmwwﬁmm. "jﬂaisiabutlmﬂnrmmk ﬁmﬁymmymﬂformooopomﬁam. Bimerely yams. m m; ofNJ).maxim Professor 19:19 9.8. I have M mind an Weak-additional reports. m you. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Burrell, Craig D. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-252 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/75e83fda3621929cb6bd5fd0ba70636e.pdf e10252b561a0ef5d0589ee7befeb1f8b PDF Text Text April 15.. 1988 In mmtamtrmughmwurmwu Mmmimumtw publicationin Wimuwmmm mmmmmmrmknmmmmvimm 03‘ minimum WRWWM WW,Imetﬁulonmm “Minna memwwmmwmm amwmmtwmmtfcihmmﬁmfmﬁmas mmxmmwmmwmmmwmmnmm Minnow-i. «magmtmt. hmmmwtmytmmmumy' Ibalicwtlditicmicaw conﬁnhmMaoWﬂﬁcm. mamﬁﬂmooa mm! WWW oxyatalliaintoronitciotwm,thvwiayotopinions IMWWmMﬁmMWmn lithium mammwdmmmmm.mm1mmm aimimmtitﬂnatyiaotmm Max Pitt. H.D. Pmtcaaorothyohintry cc: Dr. 11:11 Hrs. Pmilich � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Opler, Marvin K. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-253 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/eba52bf0703d8edcda4cb7c498f56d3a.pdf d18de3e11b74bf6273b5b06863cda410 PDF Text Text ppm 15, 19:65 4m » 230mm www.mms: M W: mmwwmtwnmﬁmmmmngmu fwmmmudm mmtontiminSom :‘ Mr. WW mummmmmmmnawmm Madmamnndmﬂnd WWW mamwammmmmamamm mbnlinvnuun Wmmnmmmnmimgmnmh :nmmmmunmtmm.mm an mthdeW. ammummmmmwum.m winhnplnundmmdﬂyﬁaciuﬂmntoﬂtﬂnntylnnf sammmm 351ml)! yum, ﬂue may cc Dr. Itil PM. Mum 24.9. of Pnyamntry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Wheeler, Stanton Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-254 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f42d0ba83062a129ecbf8b5fcc8768d3.pdf a61252beea3701cdf5c48be05cb1a110 PDF Text Text April 15, 1966 Mr. Robert F. W Hunting lbwemative International Busing” Mines Data Processing Division 220 New am Strut York, New Oarpmtion Tank 10013 Shem: m.Cmulisquimcomctm1amverymintmmd in mm processing ofommdata. mmmes inmlw on» umpmeessinganddoes imam; malog mnvemim. Form ‘ﬁmﬁxmeyammhmbemamdormmmesmdyofﬂw qmtitimimofmmulogsim. Ramthmdesm‘ibeitindemilinaletmr.lmuld suggest ﬂut‘wa discuss thaw applicatims at ﬁre-Meal College. Iwillboﬂaﬂewhrkatvariwstimsmgmnmmomm, ﬁrpoﬂocbeadmmkmtoﬁmdayu. Mmm'muldbefor Dear Hr. mtocallymuﬁmgafmmmdtyforyoutomit. Sinoemly yours, Hm: V 141':qu Fink, Way 191.13. Manor of � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Shearman, Robert F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-255 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/66c27180cebaa46c9de8a38ef5adc217.pdf 7a2129138dd90419a5f237d1e176fe17 PDF Text Text April 19, 1986 mm of Musicology Manor of of m mimity DmtiatryWm It. Richard P. Wm Wt Wm Anemia: Win, W 33103 Dear Dick, thtmmmmjnfmmmmmmm A: mmmmmmmmmumumm. mﬂipmyhavetoldyou Wierhasaﬁaedmpublishm inthe - 58 as avolm Panama Bum Munch. Ihnwmdnﬂumatiminmmncﬂyﬂﬁntyw WmmmhmrafWMmddnmitwithm curmuom‘iptatomﬂipthiamek. badmgybostuguds. Simemlym, Max fink, NJ). Professor of madam � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: White, Richard P. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-256 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c78f813c035174f29e5b5759a3fdf03a.pdf b6dc37731ea2c8c49d518875e5f4527e PDF Text Text April 19, 1966' DP. Emu E. iﬁmich Dimamr, Reneamh Divisém State Ream Hospital ' Illinois mar Mold, Galesbwg, 61%]. uthywoncaasainfot-ymmpmicipaﬂminﬁu were most helpful and I Yam Swim. (131th mmmmofmmjoyodthmtingwwm. CINP Wehawbeenmsfulinm‘gingwiﬁxmaevierforﬂn mlwne in publication for the pmomdings of this Panama in 8min launch. symposium as a Inmspammymmhttoroprrilﬁ.Ihavemplamdtm mvisedpageslﬂmdnmdmadditmlrefemeeasywham mmtqd. I believe Dr. Votm is visiting yam muful if I wand 1mm andmngemts you would tall him that we have made the have request-d that the manuscripts with Blunder. The be in thaiz‘ hands by June 1 so that publication can he assured befom be minim Imuldbemfulifymmuldaskm.vaa ﬁnendoftheyw. send his m as soon as practicable . to please Wipt 130 Thank you. Simemly yours , Professor of Psychiat‘xy � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Himwich, Harold E. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-257 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/363b671f8bc93db18fc62a4747a0b5ff.pdf b9c21e81facbe677bf1367b79cf071ac PDF Text Text [@2311 11‘. P. 1.. Garltm “me Squibb New Bnmcwick, Hod Imtim for Nadia]. 08903 Jersey 19, 1986 Pam Dear Dr. Carlton: First.letmtalmth130pporumitytoﬁmnkymfor tion md ”Wm on mtidnlimmio drug.presentation at the GIN? amazement Imwritingmtan-ywthatmlmmboenabhmmke 1315: with number to publish mmts Velma of Magma M Rum. 28 you. 06 swing as I tmst this pleases mwitmmasmdmatmuymgetﬁmmuscﬂpts toﬂminfﬁnlfombyﬂnfimtamee. Iamwriting, Mfm,tomqmstaﬁnalcopymdfigumsasaomas possiblc. My thmks for your cooperatim. Sincerely yam, Pink. PhD. Professor of Paydﬁatry Hm: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Carlton, P. L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-258 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7ae027131db9fd4157421cf1d88f4790.pdf 058fe09738d81e6b167d16b59ce37463 PDF Text Text W1 mm, 19, 1966 Implnmdkdﬂmmoutmofmdiawsimawith mmwbunntimofthnpmmdingsma voluminm,mdmwithﬂuprommswhichyw have mtlimdfnrthannuncnipta. Whimtmorigimlsofﬂu Wptsuithﬁnirfigwaﬁwmtswﬂlbomm ymwiﬁdnamk.ncﬂmtﬁmmiclcsinwhmdsmuldbe inmglmbyﬁnmdnfﬂnmﬁu. Iuphmmwriuasmydimdmmdwam mitimndiamly. numeromanuinymmmmm Ihnwmtﬂnmmipu. Youdmmldwiumm. imp, W,Wikkr, Jacobean “Jasper. Sinuvmwioinamigtmcringsummdhad Wmmmam.1wcﬂlhimif1dnmtmiw amwiptwithinnmubhtim. Yammtinnﬁwtﬂiklnr'sropwtm pmvidamintmdmtim nyhnutisfacmry,butlwou1dlihtowiﬁzholdfimljwmmtmtil mhawhndamtnmmwmcfhiarmﬁm. etc. animus, alumna of proofs, indexing, mm mmsmtﬂmldamitmmﬂm '33 InuitingfmSt.iauinmdmtilmmdofmy,thia hmmrimms Aachmlst,Icmbamd Hams: Mica}. college. antntPaychiatry. mmwmmm.mmvmty.mvork. . Ilcckforwdtoccnabomtiminﬁﬁsmm. Simemlyyomw. Max Fink, PM). Professor of Psychiatry mxp on: Marque Dr». 52 Vamrbilt Am New Yak. Nu: Yam): 10017 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Bradley, Philip Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-259 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/73bb095434878f5f0045c8310785e16f.pdf 8eb018b1a62328a6aa8df9a7dd8900e1 PDF Text Text April 19, W Rpm 1966 W. P. mm Aasociatc Professor of W109! Why Wm or “ma mivomity of Medicine Dentistry Rummy W113, W863 38103 Dear Dick, wtmtmymmagainformpmicipntﬁaminm mSymosimmdfor-mmxyvaluableomﬁibutims. As ﬁxinpmayhave told you. Elseviorhas lish thase wgsasawlminthei’ummainﬁmén “tuck. Wm Immmmmmmmmmmtyw in ywr letter of April lat m6 will send it with the wanted other maswipts to milip this week. Again, my bust regards. Sincerely yours. meessor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: White, Richard P. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-260 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/142bbd1a74f155e1c6b5f73906434e43.pdf 1d3ebb7c1c685dd8f9df97017a5ee043 PDF Text Text April 20, Dr. Jauthm 0. Natimal Bank 5917 Arlingtm 1966 Chin Road Bethesda, Maryland Jmaﬂm, Daar IE: Iii-41380 I am writing you as project officnr for Iii-11380 to bring youm—to—daucnﬁnpmmtstatoofﬂnpmjact. AsI indicatodinOctober,IwillbolaavingSt.louisaarlyin Atﬁuttim,ﬂudataoollactimmdmofﬂndata arulymwillbomlam. Jmo. mmwillbefmdslaﬂinm~11380andmmccming Maulyuacmmnﬁnmmdarmaupmisimcfm.Itil. Fwﬂﬁsmmlmmstadmmmiwmitymdm writing to you to momma! that Dr. Itil. the eta—investigator of this pmject, be appointed principal investigator for the Wimdﬁupmjectpcriod. , mm,m1imimtadﬁzatmenmybam marminingmﬂmtmwmadbchalpfuItomhm the malyses $.an York, mam-y woman-es forﬁnhandlingofymtfmdammlocaﬂmcfﬂnprincipal be fbnoud. You may mean that the mimity suggestadmdtemte thatofasubcontmct. ’mis iner 1:»quth mm, canned agmaabla. although novel. Apparently. ﬂuwitingofwd'xaomtmctmnovelm the antiwrities at the adversity of Nissan-i and to this date, mamhmntracthaebmwritm. Mpmjmdbalmmforﬁn want at the period, September 30, is estimated $8,000 and $12,000. The Assistant Chaim of the mam ham Deparwmhaaasamdmﬂutmofﬁmseﬁmdsmyyet bawailable dtn'ingﬁnamrmnmspmvidede couplem tha necessary legal steps. 'v hwmmmmmMymsatmemmmmm of Payohiauy installatim, I balim that much of the statistical work can be acmlished at Hashingtm thivamity. Drywall Stmpim, �April 20, Dr. Jauthm 0. Natimal Bank 5917 Arlingtm 1966 Chin Road Bethesda, Maryland Jmaﬂm, Daar IE: Iii-41380 I am writing you as project officnr for Iii-11380 to bring youm—to—daucnﬁnpmmtstatoofﬂnpmjact. AsI indicatodinOctober,IwillbolaavingSt.louisaarlyin Atﬁuttim,ﬂudataoollactimmdmofﬂndata arulymwillbomlam. Jmo. mmwillbefmdslaﬂinm~11380andmmccming Maulyuacmmnﬁnmmdarmaupmisimcfm.Itil. Fwﬂﬁsmmlmmstadmmmiwmitymdm writing to you to momma! that Dr. Itil. the eta—investigator of this pmject, be appointed principal investigator for the Wimdﬁupmjectpcriod. , mm,m1imimtadﬁzatmenmybam marminingmﬂmtmwmadbchalpfuItomhm the malyses $.an York, mam-y woman-es forﬁnhandlingofymtfmdammlocaﬂmcfﬂnprincipal be fbnoud. You may mean that the mimity suggestadmdtemte thatofasubcontmct. ’mis iner 1:»quth mm, canned agmaabla. although novel. Apparently. ﬂuwitingofwd'xaomtmctmnovelm the antiwrities at the adversity of Nissan-i and to this date, mamhmntracthaebmwritm. Mpmjmdbalmmforﬁn want at the period, September 30, is estimated $8,000 and $12,000. The Assistant Chaim of the mam ham Deparwmhaaasamdmﬂutmofﬁmseﬁmdsmyyet bawailable dtn'ingﬁnamrmnmspmvidede couplem tha necessary legal steps. 'v hwmmmmmMymsatmemmmmm of Payohiauy installatim, I balim that much of the statistical work can be acmlished at Hashingtm thivamity. Drywall Stmpim, � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-262 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/2c143c37bf6c3fb663955ee30aa6a38d.pdf 18fb28058539369c547a17a81481b6e0 PDF Text Text April 25, 1966 Dr. Jana-sen O. Cola Natimml Bank Building 6917 Arlington Road Bethesda. Muslim Jmﬂm, $11381 I awaiting to you as officer for BEL-11381 to bringyouwm-dam an ﬁnpmmt state ofthis project. Dear RE: 13ij w.'nm1tilmsbeenaprincipa1inmtigatormlhave bamdeliwmbausmmadwithhmmﬁmdevelopmnt ofthisstudypmm. Appmximhaly fort-y patimts have been introduced into tin‘initialpmmmmaddiﬁmalmymmbeing The mkyaioloﬂcal, psychophamlogical massed. and clinical aspects of the first forty patimts are now minted. MWmdfollowwdammnmbeing obtaixnd. 1113 Wichgieal M of subjects am under intansive md pharmacological study. second Effectim Jam 30, I can no lmgar continua fomally as wizmstigator. Dr. Itil md I have considered the possibility that mntinuationofwintomst inthis studypmgzmnaybe pmvidcd m advhoe. consultant basis and I have indicated that ImldbeplemdtoassisthiminmymythatIcm. Myltahethisoppomitymthmkyouforwursuppwt Mmmgamntinﬂradevelomtmdmntinmdgzmthof thiasmdypmm. Sincerely yam , Fink, 14.1). Professor of Psychiatry Max ac: Dr. Ulett Dr. Itil � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-263 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/9f2f3b0c0166c56644a4fed844f7074a.pdf caf0c284c3007fbb05d5ef3953639b4e PDF Text Text April 22, 1%6 H». G. H. Goran Dapmm of . 4w]. Engineering of Rochester mimity Rochester, Haw York 1&827 mm. Dr. 00318112 Fella-wing the mat in sauce of February 25, MimMImpleasedmsubudtmabstmctdeamibing 1966 our dommntatim studies for yam Rochester Gad-Emma. mMemtim for the hmmwthntﬁaiasumymhasmwpmmtothe processing and mtmeval. problem of bamdioal 11mm Wamtﬂﬁsmts to jcinmg you. wiﬂzymmappmvalmdlook forum Sinosmly yum, ﬂax Fink, NJ). Profesaar of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cohen, G. H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-264 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/567654155ada1cec7588daef58900695.pdf 9c17b9445c52ee29515a4b1babaf0a15 PDF Text Text April 25, 1966 Miss Danna La Rock Sandem World Travel, Inc. 925 Building 808 15th Street, NM. washingran, D.C. 20005 Show Dear Miss La Rock: ‘me itinerary in your letter of April 21 Planes proceed with the necessary mmts. is satisfactory. mm you for your assistance. Sincerely yours , Fink, H. D. Profesaor of Psychiatry Max Msznh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Sanders World Travel Inc., Donna La Rock Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-265 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/84c77991d91cb9d76f6ce38170650713.pdf dc37ed02ae94eb0f36c948f0bb46d861 PDF Text Text April 25, 1966 Joseph Jaffe, Chaim PM). on Research Mixes The of Paydmmlyais ‘W 125 East 65th Stmet York 21, New Yeﬁc New near-Joe: Ihava just mmivedmdmdwithpm the on practical aspects of monarch in office settings. I fomd it 5 6011131th and easily madiblo waive, dewdshtomxdyou, Claymsmymajob wallchm. IthinktMommts mgaxdinatm on therapy and the special problem of single case study we amnllent. upon Wot mm MylmggestﬂmtthisbonMavmahlemthe mamhipasamportofm Mitten-3. Simmly yum, Pink, H. D. N meeasm‘ of Psychiatry ' msjnh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Jaffe, Joseph Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-266 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/df0dbda54f257ca72b6fd1a803f41bd6.pdf edfc2fb6d549fe3010ba57d5b9fd6db8 PDF Text Text April an Phillip 25,, 1966 Bradley The Phdiodl School Elimination, England Deer Phillip: I have devoted the past two days to reviewing the manuscripts available to me. and in preparing a summary of our proceedings. The manuscripts and my nous are going out separately today. There is one special question is related to the too dommnts of invited participants. Ire. Ilymhendc and Jermr. whioh were not presented at which the meeting. quite . I e have found that Dr. Ilyuohenok’s manuscript id amend its inolueim in the proceedings. good and would With regard to Dr. Jenkner, I ampuzzled.1 have available a four page abstract. a copy of mic}: is enclosed. Wlbelimthetmoftbemteﬁalwouldbequite relevant to the discussim, and, as it deals with a peculiar state of altered omeoimea. I believe it my be considered for inclusion. Harem, I do not have the full manuscript. and this would have to be solicited. It wand be a. delicate matter to solicite the musoript and than decide as to ite suitability. I am therefore bending theebetmottoyouendwould suggest thetmdowite'to no. Jenlmer asking for the full madam. perhaps providing new caution that it should be submitted for consideration for Mlleetion. If you concur, please write directly to him, or I will be glad to do so. Inﬂuemuswipt whiohlheve justreed, lemmeking neither editorial ohnges nor oomotim of style. since the smoifio guidelines for this volmae are not available to me. I would be glad. however, to make and: editorial and typographical suggestims if we can agree on the necessary style guideline. Sincerely yours. MF/jnh Pink. “0-D. m Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Bradley, Phillip Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-4-267 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0d1c81c61acaf08f8ae661810eebb72d.pdf 5b44ac44a46a19f178e741095895440b PDF Text Text May 2. 1966 W]. Indistxy Maegan - Medical. Mr. F- A. IBM ' _ 112 {Last Post Mad mite Plains, New York 10601, Dean Hr. Powell: for ycur lettnn of April 22, 1966. fact that I will he mlccating in New Yam, I taupe that the ccllabomtion begun have with Dr. Donald Shapim (who is reheating at Washington mimity) will permit us to a suitable demonstration in 1967. Thank you vary much Danpita the m mthmeklhcwtmmgotiatingwithtm mpnaaantativcs in Na: York mending the pcsaibility cf «obtaining a 1711 and 179% frmt and cumin: fan the presently available IBM 1620 pmsaor M: 1:11. New York College. I have emphasized to the local representatives that the availability of such aquipmnt will maka ponsibla the ccntinmticn of the ewlomticna which was have begun in St. Louis withut the nccaaaity of axpenaivc and time cumming mpmgmwing. IBM mm As IwillbetmnafaningmcfnyatudicstonYczk. and since: the (18% is suppontmg this pnognm for conputcn services at a amthly rate of approximately $1100 for aquipmmt that a continuation mxtal. I believe that I could mince of this program in ﬂaw York at appmximtely the same rate muldbea lcgicalcmﬂitm of funds. While itwouldbc m W vazymasmabletomqmatsuppcnt fwafullunitcfanIBH 1800, I do mt helluva that our study in extensive such a facility fun a single user. Rather, enough to 1' believc we can contribute heavily to tha {mammal from New York Madical College for an IBM 360 System. Weaver, this is sanctum in the film, and I an writing to tell you these details became in my diamaaion with the IBM mpmamrtativa, Hr. Robert Shannan, he indicated that my present suggestion for such an upW‘wwld be difficult to achieve and thought hemﬂdcalltoankycm'advicc. Imuldbamtaful fonany asaistm that you could give him. I will be in touch with you late in the Fall. Wt ‘ Sincemly your-s, Fink. Mal)Professor of Psychiatry MEX mnjmh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Powell, F. A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-270 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1d0ba2e0acfe6f73bb21a3041a09b821.pdf 00ee49702b3a18ea38db06d3bce7045f PDF Text Text May We“ LI KWM. 2, 1966 “‘DI Assistant Professor Dapamnt of Fsyehiatry New Jemcy Collago of Medicim and Dantistzy 2“ Baldwin Avenue Jersey City, M 1!». York New mm: W Thank you very moh for yam kind invitation to participate in tha posh-Waite of the New Jersey College of Hedicim and Dentistry. It was kind of a». Dahlb'em ta mammal w participatim. and I would be pinned to make whatever attribution I can. subject of the gamma]. and specifically. the nemphysiologiml activity of 1.31) and mum 3&1).ch is one that has been of midemble interest to me am! my associates The forﬁwmt ferayeam. Iwmldbeplamdtodmmsmwork (What's. and the available studiesby Effective June 1, 1956, I will be at the NW York Medical College. This will make: my participation bath easier and much less expensiva. My We. will ha: meesaar of Psychiatry Departmnt of Psychiatry NW Year-k Meal College 5th Avem and 106th Street Maw Yak,_Nm Ears: 10029 Thank you once again wishgs in a amsaful for your invitatim and mm. best Simmly yam, Fink, NJ). Professor of Psychiatry Max Hfzjm my � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Kurland, Morton L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-271 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/184b3a3f3a238df87668ec71e33d89ab.pdf 122252bf792a6599efefa267b3e94206 PDF Text Text May Estelle Dr. 2. 1955 W11, librarian Meal Library Washington University 660 South Kirxgehiwmy St. Innis, Missouri; DearDr. Bremen: I have mad with great interest the reports of yeur matings with the Intemnivereity Conmmieetims Oomcil. and especially the proposed develepnent of a mime]. network for information handling and retrieval. I trust this program will go well. I emwitbxg to extenduymimetim in the (Jemima for Emmivcmity Cmieatiens Cow-sci). since I have in order to swept from the Selma). of the posit-ion of Profeew of. Peyehiatxy at the NW York Hedioel college, effective June 1, 1966. with all my best wishee for the emoeeeful development of this prom. I remain, 7 new mm Sincerely szmh we, PM, ”.13. m Professor of Paydzietry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Brodman, Estelle Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-272 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/88fa15d9ef77c63c9fad737686f7f5b4.pdf 16de320c5d347e805cff4222f281e284 PDF Text Text m2, 1956 Wham: Impassedmmmmdnr.mwthmeh1tz mmm W Immw.muuuwmmmummmm Mmfwmmmm . Kim‘s... tar- A. , meantimrnmmmmammm ammummtmmyarmwsum Wm. Aujwmothissmdiesmmmdte W m w,mdmmﬂy.mmwd Hehasnndesi Wemdnmpmses. cantvihztimaafhethatedmiealmd mums mﬂmﬂmmmﬁuqmutyothismmm cxosllmt. I‘xaveviaitedhislmummdrfugability »» the mammwumyu, mmmesmthsmﬂmusualmtminingofu wxuidavnlnpmximlequtmzt , high. WW.MWMWM®WW Iduheliumﬂastheeanmake Imuld magmas-macaw. mum ac: Knuth Lifelike, Md). eigmiﬁomt I � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Ellingston, Robert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-273 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6e01212d8bc5acd0339a72c368ac3c86.pdf 031e02d80cf3cf3eaa8dbeb914b88ded PDF Text Text Hay Rabat-t C. I’m. 2, 1966 Mien M1031 Liaise!) Staff Clinical Investigatim Departmnt Smith, Kline and Prune}! Labozutcxies 1500 Spring Garden Smut miladelphia, Pemwylvania 19101 DearBob: Islwuldliketobringymwtodatemﬂmsxfstudy doses of ambarbital dummtias of different www.mdaumlleoﬁmpmse hasheminpmmsstormﬁmﬁvemnﬁm. Asofthia MWW. dam,twsubjwcsmmwmlm,mdﬂmmmmadditimal of clean six response subject-"a who are in process. muse subjects mquire butinaofaras unrequited four, mm, itwilltakefowmlcstobemleta,anditismyexpectation Mlve additional mtanﬂndatawillbeoollectodbytmmofﬂay. Data analyses will begin prowtly and it is cur expactatim mtmwillbeablemcouplmtheamlysea dam-ingthesmmr, harming any WOW statistical or analytic problem. 9.9wa, Iwillbemvingtotmﬁew‘fokadical Despite this transfer, It is College early in June. my intentimtoompletethissxfsmdymdmdoso, mydata analyses that am not couplemd here will be mlated in Maw York. I will wally mp1: thethisresponsibility for write—Mp and the natavial. the pmsentation of WaddmsainNmYozkwillbe: Dapartmnt of Psydﬁauy York Bhdieal College 5th Avanm md 106th Street New New York, New York 10029 I will also be spending part of my time at the Mempolitan Heapital. Ifyouwishtomachmdm‘ingthenextfewnmﬂw, muismdmysem'tarywilltellyouwmm Ian. phasecallSt. Hy umber at Metropolitan Ibepital 18: 945300. Ext. 720 (708). At the Wivemity, the number is 876-6500, Ext. 1455. (That is the Quimm's number, and his secretary will mmlly know Wt Mmlmnm‘willbeabletotmamsage formmtilIhave my am seminary.) ‘ �Mr. Zwahlm City. (emtinuad) Thank you You mat for the invitation to visit you in Atlantic know that I have anjoyad mm mlatimship ﬂuttmdatawillwmtyowfaith inourmrk.deI'npe Idolodcfomardtoemtinuingtoworkwim vars/mien, specifically with Dan What. You may be interested me of my responsibilities is to establish an Early Clinical mug Evaluation Unit with both in—~patient and cut—patient facilities. I nape that I can amplish them SK? and to hm that mtlhavetriedmacaauplishm,andlookfomardto My best regards. Very Fink, M.D.' Professor of Psychiatry Max Mfzjm sinmmly yours , � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Zwahlen, Robert C. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-274 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1f2793e62fb4328296c40f7a1a6b4b34.pdf ae3a212a11d55f5e5e1db9578be0603f PDF Text Text Dr. Jonathan 0. Cole Netioml Bank Building 6917 Arlington Road Bethesda, Maryland Deer Jonathan faded with e amber of technical and administrative with regard to the preparation of a grant application questions New York Hedieel Galley for the Ice—establishment and free the I am malytio program for "BBQ and Human PsychoRetherﬂmepmdﬁmtimonﬂretelepmor in letter. I believe we both will be in Atlantic City for the meetingamxtwasm Implaminatemive Tueedeyeftenmn and Thursday. Except for my and will be available 2:08 preheateﬁm on “muredey at pm... I can set aside any tine development of an Wiley." may on the rant of the schedule. that I we assist would be Wain). if you would indicate a My m in the privacy of yew to in the preparation of this project application. might get together me half—hour twat Sincerely yom‘e, m Fink, Professor of Psychiatry 24.13. ﬁxjmh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-275 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a4ab180e0dd50f3ff7771786321d54bb.pdf 059595d6f16cf348bc3721d4ab1451c9 PDF Text Text Dr. Jonathan 0. Cole Netioml Bank Building 6917 Arlington Road Bethesda, Maryland Deer Jonathan faded with e amber of technical and administrative with regard to the preparation of a grant application questions New York Hedieel Galley for the Ice—establishment and free the I am malytio program for "BBQ and Human PsychoRetherﬂmepmdﬁmtimonﬂretelepmor in letter. I believe we both will be in Atlantic City for the meetingamxtwasm Implaminatemive Tueedeyeftenmn and Thursday. Except for my and will be available 2:08 preheateﬁm on “muredey at pm... I can set aside any tine development of an Wiley." may on the rant of the schedule. that I we assist would be Wain). if you would indicate a My m in the privacy of yew to in the preparation of this project application. might get together me half—hour twat Sincerely yom‘e, m Fink, Professor of Psychiatry 24.13. ﬁxjmh �~2- Dr. Human Effective June 1, my May 7, address will be: Fink, NJ). Professor of Paychiatry Max York helical (bllege Avenue at 106th Street New York, New York 10029 New Fifth Again. many thanks for your cooperatim. Sinonmly yam . M, w; ﬂax Fink, Md). Profassor of Psychiatry ‘vv:'mvi“v.<“'7- —r .7 “ l‘ﬂﬂ—n-wnm’.v~r;y~ 'wu-maw Hfzkp 1966 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Hewson, J. Robert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-277 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b00b27992e54c20c30dd1b2152b7a1ff.pdf 649d34bbec28c6f2f0a5579a55962fdb PDF Text Text �HP. mu W 7. ~2- 1968 Mmmmmmmmhmmmw mm‘zmtmuinbowhwnmﬁmto Warm. m ﬁnk. a! mm mum 21.1). mu: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Burrell, Craig D. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-278 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b28a75e38699477aaa2634c7b751ee0c.pdf 68e63be4587d0e65eed13e2aea9caf06 PDF Text Text May 9, 1956 om.mmomsm WSW! www.mm r mum: Immitmgﬁdslntmof' Ihavs m.mmnmm,mm:.mms mmmmmaummszmrmssMsmtmt inpsydzimyettmriillsidoﬂospitel. .. . an. mm pertinipetedina Folemid-wymining inferon dining ﬁn“period 1951;»58 Psyohinuy m m Whilst Ministeimdnpsismpmtiosofmmopsynﬁm. Sines issawrmnmmmwrmmmofmm imninolinionlsanction. At mimmmpnyansmmmpmtim. antimihnvefomdhimtsbssmntsimonn,ﬂm Inhisianm www.mfamdhisolinioujudmtmhe mihntmdmmtplnesedﬂmthsmehlstomute - emofstudiss,mofminummimtadinsspeoislm mmmim. Invehudmdtmtyssdismsmssssloadwith himmmmmmimsmfomdhisdescriptimsm Within: Wmmmwmmm. Whlﬁﬁaxmfemdemofwmtm mtﬂlyintshiswnnnimmtmﬁﬁedhyﬂnir Wm. Iwwmmommdmm mtmmmmmmmmmmmmpam withentlmissmmdintmst. ImuldliketsaddthetIheve mmmmnmmmsmmmmmmmly Wadmmstmtiﬂsdmnmmpnmmof Wmestablished. Immmmmmso pInning. Ibsliowkukeplmommduinmssimificsnt mtrihxtimtothsmspim'epmgmn 8W3; wars, Hex Pink. NJ). Professor of Psychiatry co: Dr. A. Kaplan � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: North Shore Hospital, Credentials Committee Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-279 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3bf9143996d316b3eb5b714a917445da.pdf f419da1333f72825e6b27c730aa3b0eb PDF Text Text May 9, .1966 Wmm Effie” Macadam Mm Metric Susanne thm Mr. Public 1700 '1... Robinem Washington. 3.639908 . NM. Effective June 1, I will be! at: Fink, Md). Profmor of Psychiatry Max Meal college New York New York, Fifth AW at 196th Street New York 10029 I muld mmst thet mmicetim after that date he gem: ‘Sizmmly yams , Max Pirﬁc, H.219. owem of Psydxiatry Wzkp time. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Robinson, Robert L. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-280 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/71043fb37c9683e020612ccf39590e15.pdf be3a420274695ec20266bdb57eb64772 PDF Text Text / .qw May 17, 1966 mm B. Toms Intemtimml Research Programs Sectien Reward} Grants Branch National Institute of Manta]. Health Bethesda, Dear Hrs. mm 2001“ Re: m 12973-431 Tm: I have read the applicatim for a travel grant to the First International Swim can Blemleepthamw and Electthamia with a great deal of interest and I am mteful for the opportmity ta have reﬁned this problem. While I believe that the pmhlem described and the methods are of swiﬁcam intemat, I am mauled by the absence of any paydxiatric interest or partiaipation either in the recent in St. Louis or in the proposed list of participmte. swim Speaking candidly, if one could be assured that at least two qualified Mariam research psychiatrists with clinie‘al experience with either Waive therapy or were to attend. this applicatim should be mmmd for support. The list of invited speakers far Exampe contain no names that are familiar to me as psychiatrists or murmhyaiologists. believePrecisely for this ram, and. because the that the tectmique indum behavioral changes, the presence 91’ qualified psychiatrists would make wwﬂnmile the expenditure of the additimal funds to allow other American physiologists and animal markers to attend. I had called you last week to obtain sane additioml reports from In“. Short, but was fortunate in obtaining web enamels mute Alfred RichaMam of the infmtim from Dr. Louis of of St. Physiclogy Uniwmity. Based on Depéutmt infommatim and the letters admitted, in the the applicatim. would like I to specifically anmr your request within the dated August, 1965. guidelines I believe that there is scientific med for thin conference, and since the greatest has been 31m by European ommdzatima. the inter-rational meeting of the needed mm �Lorraine 3. Torres would be an «2-- my 17, , appropriate pleoe for our scientists to obtain fruitful degree of Mention. The spomoringegmy may be an appropriate an, elthwgh. the Society of Biological Psycmiatry, were their when intmsted, might be were a appropriate. more is no oritioimn of the setting. the budget, or the plomed program. The principal oritioiem ie with regard to the mlevazm of this meeting to the Maximum Institute of 231so Health and to a provision for reporting the resultato American psychiatry. The“ two mquimte are looking. For this mom. I wild that this wont be approved with funds two rental health only if qualified payohiotriete were kmam to attend the noting and were willing to mmnioote their to the paydziotrio monity. If thio be audition om met, I would assign a priority of on. me! Wetim additional referees I would Professor of Temple Wmiw, W,meeeew Minimtion Facility in of at As Vetemns Holt. Psychiatry ‘ a More Illinois and Willim Hines, the we 13m. Charles Libereom of the Albany Meal College. Wyoumymhfmﬂwopwmmwtomim this opplioetion. Sinoemly yams, M7 mil Fink. E. Di meeeeor of Psychiatry 1966 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Torrex, Lorraine B. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-281 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6f318e056f9e3bbeb4166cacaf6709a1.pdf e378cc3ec6e5e3f26762b7f9b55027b1 PDF Text Text '7 77% m" ‘- rgl-‘PI’VU.- ‘9" "9w v.‘ 'r. WWW Mny mm. P. )4. 18, 1%6 WW Clinic Udvhmity of 1m: Mattie: m, Wm m. Rickardsm of Dinar Dr. Wmitymkindemugsto unmmﬂﬂngefﬂmfomhoaunglmemﬂmlWimm 81:. Louis mmmmtely,tndidmthmampy Emu. ofﬂwpmgmwailable,m1mwriﬁngmaskifaoopy ofthapmlimmarypmmmdaﬁm'infmtimforinmmud pmicipmtamuldbemmilablamm. M you for your Winn. 31:303me yam, Hm: M”: 3m Fink. MJ). meosm of Psyd‘miatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Wageneder, F. M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-282 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/01da6ab29cc3cdd3b466c4d8edfc76f4.pdf 009104cc709a512146055a0f29fc24ac PDF Text Text ‘ 3 é ; E May mom (311M Health and mm Natimal 1):». Wise Emmtiw Sammy W of ibalth Instm 2003A Bethesda, mar Br. ijm Timon: 23, 1966 New ItwmmofywmmeﬂumjmtSiteViaitW Duke University Applimtiw. I fomd the mom: fer tin Ram mmﬂactmymmtmzkingwwmnmdlbamwmmmm were mainently fair both for ﬁm adenﬂsm inmlwd and for the NIH program. Wmfmmwmityofmmngmismpm. Simumly yams, M FM. 14.9. Profesm of kap many � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Thomson, Louise Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-283 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6f6db19c8504139a618097389dfeea55.pdf a47cba753ca89f40eddb0623ba2e8d18 PDF Text Text 10, 1966 May To wl'm it my cmcm: Miss mmmmappointsdtoﬂxe Wtsrf‘acility' at the Missouri Institute of Psychiatry in February 19614, as - analyst. In Jmusty 1965 , when the Institute boom of the mimity of Missouri School of Medicine, a facility Miss was appointed as msesmh sssistmt. ms Conputsr Facility of the Hismi Institute of Psychiatry is an affiliate of the Bustlingm thivsrsity center. prom Him War Him this pardod, Miss has been mapmsibls for- data machine processing, opustim, ms the integutim of this unit with tie larger miss at Washington Faring the period from Psbmry 196%, to Gotcbsr 1, 1885, she was directly msponsibls to m. Since October 1, 1965, she has been directly responsible to thsDixscborofthis facility, Dr. Slupiro. Shehssbsen an inﬂow part of study mar my supervision, During mimity. am WM. prom includingsuchspeoislsspectesstm qumtificstimofmslogﬁﬁe signls and the library study prom for information mtriexrsl. thhispeﬁodlhawfmmdﬁissﬁicmmtdﬂigwt, cooperative and pleasant. She has assume! responsibility and smarcised this with test. discutim. and has dewloped the facility to this W signals, ssitdossofmmﬁlnowithnmm the handling of specialimddsvicss for inclwing tape recorders. She is sssocistss and I have always fomd it a pleasure malog wallmcsd by herto work with her. smallest judmt. She installstim, consisting Amjorpsrtofm promwithwhich I luvs been identified will he terminating at this Institution in the Fall of 1966, as I an relocating in New York. Miss Minimum for the duties and services for I would which she is capable wiﬂmt mamstion and mid her as an excellent W ma War. Sincerely yams , Max Pink, 3.1). Professor of Psychiatry �May 9, 1966 Towhanitnnyooammz W Camtmaeﬂiolonmwaseppaintsdtoﬁrewterf‘ecility Institute of Paydﬁﬁzy-in Jme 196“, as pmgmmnr at the the Institute beam at facility of analyst. In January 1965, Iﬁssommi School of Hadinim, Miss mm was the miwmity of Miss m appointed as research assistant. of Psydﬁstzy mm Institute War 0mmof the Washington University Center. affiliate this wind, Miss Him has been mpmsible for date pmosesing. mm operation, and tho integratim of this unit with the larger neuter at Washington adversity. Mag this time, she has been directly tumble to the Disaster of this facility, is Facility of the The W an Br. Dmaldh. Slupim. mustaenmintemlpertafnmnmus study w supervision, including such main). aspects m infamtim mtricvel. pram asﬂaequmtifiaatimafmelagmsignelsendmelibrmsm prom for W this period I haw rm Miss Him moot diligent, and plaaeent. ﬂan has assume! responsibility and «months examined this with tact. dimtim, and smellem: judgxsnt. She has developed the fanility ta this inetellstim, consisting as it does of m IE4 1710 with nummxe specialised devices for the handling of analog signals, including tape recorders. She“ is W mllliksdbymessaaiateemdlheveelweys fmmditapleem work to with her. part of the program with which I have been identified e1: ﬁxis Imtitutim in the Fall of 1966. as I muting New York. am mloasting in A amnion will he Imuldmmodtﬂssﬁickmnforﬂndutiesmdoewiaesfor mahsMieaepablewithnutmeervetimmdwwldmmdheresm exasllentao—warker. ' Sincerely. yours , Max Fink, 24.1). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: To Whom It May Concern Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-284 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/955a9fc43421a5db1996afc62f6a3f5b.pdf 4d108982c6b4797c15fa7e217783cc8e PDF Text Text May m». J. Robert 10, 1965 Wm Assistant Dimamr Clinical mwaﬁgaﬁm McNeil Laboratories, Inc. Cm Hill Port Road Warm, Pemmylvmia Dear Dr. 33mm: Ebnmixgyourlemr,wehavechecmdmmfileaamifind 1:13:9an suppliesmbeingmtmd under sepamte cover. tablets tablets/bottle 12 bottles 12 bottles «lmg/ml—mmlhort‘tles 82 2» -— 5 mg We - 2.5 ~ so 13/1111 A Was - 1 mglml mm): you my mm for WW Wﬁm. ﬁinoemly 1m, Fink, m Professor of Psychiatry MOD. 1'?sz � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Hewson, J. Robert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-285 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/35cb343dda8645fa46b6917d8ee73631.pdf ccceab95e31cd20e6b05cce160fb71e1 PDF Text Text May m Ms W. 10. 1966 mmr Cu Manhattan State Hospital Island 600 E. 125th street 7 Ned York, New York 10035 Dear ﬂy: The data analysis of your firm: study is owning very It was first Weary to ﬁ'zack seen of the records Wmmwsesaawenaeselectmofmmtmmm for the study am one had been collected. 0n mmelyais who of the well. in the WW“: position. form We no variable again showed diffmm mg the one groups. item with . this we analysis. equal analysis. fordatemintngthe the thm drug omditims. We will be rm beam the tumpmm mg off axiom}: undue shmldhavo the data available within ten days. mdhaswittm differences Dan has; Wehawpleyodbeekmofymmmtmmﬂmlymd mofthemom. Withﬁmsapwnmpmmdbetwm we have no difficulty in identifying end-n As you also provide no difficulty. mic, ma form's etudywemuld preferaminimef times and 1mmm, saw)», and the analysis four-five pretreatment recordings. I are returning m tape and our: playback with the suagestim that you told both until a (incision is necked as to which fauility may be able to accomplish the mlysia. ’ minim I have defeated wiring up the behaviaml materiel until w have completed the EEG analyses, and will dismiss these with you within the next few weeks. that been Wing to New York weekly and believo will astebliah a water mlytic facility at tho I rave we College. plmd If I don't see to attend the you Em in New ms: before then, I have I will Meeting on June 2-3. �Dr. Berber ~2~ probably take the: 7:00 p.m.-8:00 p.23. air shuttle from May 10, 1966 New York onWedusdayavuﬁng. IwillcallyoumWadmsday, June 1, to see In: you am getting to Washington. My best regards. Sinoemly ycmm , Max lizjm Pink, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Denber, Herman C. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-286 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7ce4d7ae6dfc8c346c3690e8eb6caa3e.pdf d95b7a05391d0b2f12d67b44ccaab4b6 PDF Text Text Phy 10, 1966 Mr. 10! Stmlny Gold Gummy Emmi 8. Kenny 2503 m Clayton, Missouri 63105 Dam? Mr. Gold: wouldywkindlypmsaasupplyofl-cyclomrmmﬁch inmmsulnaafzoomeach. mmdnlivwingtoym,200m, Iwould unsiuofwnulewm in forties or fifties. appmciam these being bottledWym.3. willomﬂmacamtprimof $50.00. This Wyaplmbiumdimatlymmmwﬂlbe 3W5: yams, paidhymmimityofuissmri. Max Fink, MD. Professor 0f Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Gold, Stanley Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-287 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e751042822540bf3ea34c84ba50df2c2.pdf 29cdb0bd4141e01256169be23e5f3cba PDF Text Text May 16, 1966 Dr. Jamthm 0. Cole Maximal Dam building 8917 Arlington Road Bethesda, Dear mm Jmﬁma I enjoyed our mating in Atlantic City. m suchmats, I thwght it be helpful Following yum would is ask We to Wider his positicm the transfer of the equipment which was broughtnew from 1 hope that I can nominee him that Hillside this is a wiﬁmut having so ask to with Mini. any m minis We official Wiestion. andadvioeinﬂw Myanformmistm Whydmhmoology-Omtar study proposed My WOW. best regards. Sincerely mm, m). meessar of Psychiatry Hex Hrzjsh ms, � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-289 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/54b663f21bd3fe2d3364a4c5abb31338.pdf 7150b8aca97b01aa20efa33b73782f58 PDF Text Text May 17, 1966 B. Toma Wee International Research Prom Section Mew-oh Grants Emmoh National Institute of Mel Health Eethesda, Miami 2001“ Dear the. Re: Hi 12973-01 TM: I have read the mimetic») for a travel grant to the Symposium: on Bleetmsleepthempy and International ﬁrst male with a mat deal of interest and I am grateful for the opportmity to have reviewed this problem. While I believe that the problem an and the methods are of simifiomt interest, I am humbled by the abaema of any paydaiatrdo interest om participation either in the meant symposimn in St. Mamie or in the proposed list of pantieipmta. Speaking oandidly, 11" cm owld he wound that at least two qualified American psychiatrists with clinical . , mew , daemon either mavelaiwe therapy or this applieatlm should he mmmnded for support. The list of invited epeskere for Buoys domain no names that are reﬁner to me as psychiatrists or Wysiologists. believe Precisely for this mason, and beoause the that the tedmique induces behavioral oranges, the presence of payohiatrists mule make mmne the expenditure qualified of the additimal funds to allow other American myelologiste and animal mtkere to attend. eaqaerienee with were to attmd, Write Ihadoalledyoulaetweektoobtainmedditioml reports from Do. Short, but was fortunate in obtaining moh oftlmmededlnforeetimfrmbr. Alfdeichardaonofthe Department of Physiolow of St. mule deversity. Based on the inﬂammation in the applicatim, and the letters submitted, I would like to specifically yaw request within the guidelines dated August, 1965. I believe that theme is scientific need for this omfomnoe, and since the greatest lntamdt has been sham by European organizations. the intemetioml meeting mm �mine B. Toma . -2- May appmpriate plane for our suimtim to obtain The mowing agency a fruitful dome of may be an one. althmgh, the Society of Biological ta Psychiatry, were their immatad, might be more Then 5.3 no mama of the utting. the midget. or the: ﬂamed prom. The primipal criticism is with regard to the mlevm of this wins to the Hatiaml Institute Of mm]. Health and t0- a minim far mpartim the Insults to Mariam psychiatry. “mace two mquirwmta am lacking. For would be an " Ware. Wanton. Wm thiammn. Iwouldmmmdthat this wtbeaypmvedwith mm funds only if M qualified psychiatrists mm manta}. know to attmd the mating and warn willing to their obmaticm mum am has to" the. paymiatric Wty. mmimte this; If met, I mum minim a priority of W W m. additioml Mama I would diaries m.Liberaon 3mm“. Manner of Twp!» Uhivnmity. cf the Vatem ministration mtg-i in Hines. Illinois and minim mm. Profuse: of Psychiatry at the Album! Medical Beluga. As tamiew. mmwummhfwmowomﬂﬁty ~ this mitigation. ' . Simiy m. PM; N memm of Psychiatry Mon- Mszmh 17, 1956 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Torres, Lorraine B. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-290 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c70dd5c389bcede0809f39a549c06f5f.pdf e67747a74fe55b599abdaf9621d6a10c PDF Text Text May 10, 1%5 Dr. H. Vojmdaovsky .mmmtory for Experimental Paycropaﬁzology metitute of matrimony of Public Health Caroline university Prague, Cmctmlovakia Suhool mm: Itwasayeat pleasm havingyouvisit usinSt. Louisand ItwpaymaajoyedyamvisitasMaswanjoyedhavingyou. IWﬁmtywviaitadeYcrklaatwaekandImgmtverymch thatluasmtthem. IhaveheencwingmNewYor-kforafaw dayaeadmmekmdlammyaettingupwmlabmtories. Dr. Simeonhasgme madmdhaswrittana fine manuscript descrdbmgcwexpericnaeawithd-cyeloeerm. Asscmaswehave areaamablygoodcopy,wawillaendonetoyou. Thankwawrymchforﬁml—eycloserim Dr. weenie andIhave just inmmstedingivingthismaomofowpatienta 200 In he the wartime, into for to capsules. put it m Wged Ihmcmrtaetedﬁremwmugminimimandﬁmytellm thatﬁsamafawfactatkmtwillbeneadedhefommcmmceioe in patients. Specifically, official pamiaaim to um ﬁns ﬁxeywouldlikemhmthemufaettmingmes, the controls for writ; or stmdazdizatim, and any infmtim regarding stability. Inmﬁmtthisisaekmgverym, butifauchinfcmetimis available (and it would be just as acceptable in Cmcroslwaldan as in English), it mad melee possible the legal achninistmtim of L—cycloeerina. If this Maturation is not available and there is describing your authsmiaatim for the use of my official Lacycloserine in patients, perhaps a copy of such authorization may beuseful. Alammopmdmadﬁxis Waforyou, andis it W Wt being used new in oﬁnar studies and by winch investigators in which laboratories? mt You mdemtand that ow Food and Rug Administratim is probably closely approaching the high stmdaxos set by the Eastern in me control of science, and my help you can give obtain permission will he appmeiated. to w mm �I Dr. Vojtedmsky _ ~2— May ' 10, 1966 Dr.81memmllsmt%mthewilljoinbothDI-.Itilanduyself iandemmtmwinhawmoppwumitytoviait mmrmo ~21mvierhaswdmpublishampmmdingaasavolmin W fmmuawdthinmmfowm. ”cam; Lu m EumchuﬂyouwnlbaMMngnm-edeﬂnimly mt W4» Stanly m3, ﬂax Fink. 94.9. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Vojtechovsky, M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-291 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/422fa0ac7292ae95cc2113021f36d9b0.pdf df974eba6b4a61fb6b1dcc3ab7892886 PDF Text Text May 13, 1966 Dr. F. M. Wagenoder Surgical Clinic- Univemity of W, Austria W Dear Dr. Wagenedar: tell Ir. me Molar-dam of mthing St. Louis {River-airy was kind among) Woman. ofthopmgnmavailabla, and I amwritingto ask ifacopy Euchre-amnesia . to of the forthcoming Intematimal smegma: he did not haw a copy on and aﬂm information for inmmsted mm be available to . participants wad of the preliminary made ma 'lhmk you for yam" cooperation. Sincerely yours, Max MP: ﬁlm M, M.D. meassor of Psydxiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Wageneder, F. M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-292 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/496a8e2b6acb400026b3611e647eee27.pdf ec915c1e79a49442fc11956f787a29d7 PDF Text Text .. y—“w m yaw—«Kwrvy‘m‘l’m' . mm V. ..V.. ..n—-v,.m. .v»w_-_..-. —.—....‘,r,j._ __, ~ ,_...-. . V. , , Him—“m- -. WWW“. "my m. WWW—v. _,V,,,_ My 23, 1936 W mimity W. K. of main: Mains, Sammy Dear Dr. Heixmich: Iwiahmmwuforymmkindimitmmtoattmdm As you W, ﬁlms unable to Swimm Pschmpnhology atmhutlmmtcful forymrmmmmesa. Have almmmiwdymrmyrmimmmwlmof deal of interest earlier promedings. I have mad this with a mat Itil fwhﬁngﬁngtorsyatmim mdlmtﬂmkbomymmw. a ”Mass of atmiies which, I believe, will make a major contributim to our Wading of tho ammonia promos. Ilodcfmmsoeingminﬁmm,w£fmopportmity mmxtsimlffmymtomtotmmmsmagdn,l wouldbeplamdhahwymviaitminmymlmatimim NewYommdicalmmgo. SW15! mm, Pink, Md). m Professor of Psymiatxy ‘m ., � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Heinrich, K. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-293 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/11e3dbbcdf99c8a886dddc864f1f76d0.pdf 9d753230700d8849ea12efa996919430 PDF Text Text w v.7 W-" vwm'vv ~wnm—m. ~~vw—.m. -.....w.-—-——w , v,- .—- Tm w-wwwr-mr. . "ﬁvuwu -r“v' w- me .wwvmwnm‘wvmmtwlv anw May 23 , 1966 l E ! m". Bane Haitian]. Wm of 1mm: mum Mylar-ad Baﬁmda, 2301i: www.mz ' W.Eumm$kaofmnemmracilityattmmlmd Stateﬂospitalwaakindmgztosuggaatthatxamdymampy ofmemlosadpmpﬁnt. I have: put this mminl togeﬁmr to provide with a (ﬁends interested many mm den give a which am publimlly available. A of tho appﬂuatims of those studies dafinitiw in mm being writtan and will be submitted for publicatim. Wt Mﬂerimaofmutmhmmmmmmmmm the Dr. Shapim mid m W Sinonm'ly yours , H.13m m, meeaanr bf Psychiatry .— W-w‘ vW,..r � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Waxman, Bruce Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-294 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/26a6015d56196838c90b488bfee97ad9.pdf 977a5065aab45a99122ef994e9bf05d8 PDF Text Text May 23, 1966 Dr. Willim 2mg Howital humRom Wimm Carolina uni-mm, ‘Dear Dr. 2mg: Itmaphnmtalkingtoyminhtlmticcuy. Iwuld Mmmewmmmamofyowmmmlmvim haw axis mvimd at tho radical Schoel. so that I I mt am moms copies of the pmtatim in Atlmtic City anmllasthe when pmpmbym'. Stupimmdnyself. The prom an included and I mum be pleased 1:0 discuss this with you be av at your plmm. I dimmed wiﬁu taful few any Dr. Siupim the l‘arkavim Model and I would of yeur reprints and proprints whim may he: lcsoﬂmtmmlommahwtmapplioatima. I was also 91:1de to review the effects of various meleepmdwmﬂnbeplmdmmampyofymmpmsentaﬁm inAtlmtic Citywmnasthewliermetoﬁﬂchyoumfamd. We My best mm . Sixmmly yams, HEX Fink, Mum HOD. of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Zung, William Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-295 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/407eed1743443b13fccb74a8164fd7ef.pdf 102729b2fd71e38ebc2f49205447a52e PDF Text Text .w -.- vw.vw..-,.—..w-n——. www-m"v... w ”UMP...L ‘ . -. -- ~_...,-;W~ w- www' w—rww"-mw W W, W m. Nathan ,— - r— ,,.—vv.~mm-» ~ —. -— v—\ ,, w m ‘Irwrw 5. Kline State I‘kmpital New Yam “a“. Whamofﬁnmmwhichihawmﬁmly to for the muting in mm hie 8am fm'trxxmﬁng Madrid. In latter to me. he indicated that the full paper should be approximately twenty minutes in langth am! we will abide with Inhouldtuwthofullmxtavailablabymond agatgzidalixu. 0 June. My best mm. Simly yours. m M, 11.1). Mum of Wintry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Kline, Nathan S. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-296 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/cbe9bf8ea44a2d734c9850feb82fa7bc.pdf 532cc402283c32036adf0c57b7d33a2f PDF Text Text 1-wvn- May W Mom Holt Albany. York Dr». 23. 1966 of Psychiam Now M8111. IWWMwatMWWﬁaqmdmsmch mqulam ymmiudinmmmntkmﬁcﬁty. mmlwﬁjobinmhtingwmmmﬂummlhiatmyof studies, meadow remand Walt new Iwmmﬁlmabhm Madman. on the your mﬂmmmll,MIfeltﬁmtﬁmWﬂutm mmMYMmmoiwfﬁciemdcpthmmvidemW mmwmtywummﬂmtmymmiw Mlhndtimtommr. Wsmmtsmuking Perhaps itwinbepmsiblotowmmmﬁcrsmdiesmceagam‘ fwsmlyithmimmtﬁmﬁammmty. Again-L. 21y distim. Simmly ma, thwks for your kind W HM PM, Man. of madam � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Holt, William Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-298 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7d0a443394176430f54a69f23e196591.pdf 0319d75d7472c0b80fd60a67f569cc05 PDF Text Text May I». «33 23, 1966 mm leW mmm {no Boston 15, Street marine, I ta haw you Chair the msien inAtlantic Cay. It was aplmm difficulty. that I did not give yen mt 1mm: Ywdmmmvimmofmdmmmalityasm"m in a minimum demiztim. the want}; W m” Iamloainga~* miehmvmiehmsmimmofow Imalmtaking ﬁxing mummmmfmmaneimd. ﬁmﬁbertyofsandingyouamwofthewmutypapsmm BobKahnmIWMImatmmidu. Immimod. mmummmmm‘nﬂnmmmam, WEB an as inmortant in writ: am W mmmwmxmnmmxmmmmm mica'tzgstmaumhtowly. mummvalwu the for mmdsive in that the pemmality «2: {mm}: as thc mophyshhﬁcal mama to mvulsivn disappointed that my ﬂaw people chmgaa Wives. I M mmmnsum manual etudiea.andwdieappoinmnt is the infomtim rm Wraps: pmmsa, mad, ample, litthstudydanbyBMﬂymmmmnmmﬂngm-nm Mmit. Hybestngam. 3321103:me 31m, ﬂax Fink, Ed). Profaswr of Psychiatry ﬂaw � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Alexander, Leo Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-299 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4b7e2e7f0d71bcfa0d38d037fdba5006.pdf fd5fb03587c3d6fd5d187b4f78fb14f7 PDF Text Text May 23 , 1965 Ex. Louise Timon Emwtiva Semtaxy Child mm and Him Wt rhtional Bastims of Health Beﬂwsda, Dear Dr. Mylwd Prom 2001“ 13mm: It was kind of you to sand me the Project Site Visit Report for the We University Rem: Application. I fomd t] mpm’t to reflect my own thimdns very well and I believe the were eminently fair both for the scientists inmlved and for the midis 16: NIH ‘— —. v v .w -— . program . Thank you for the maturity of reading this report. Stately yams, — w « — v .—.—._«»-,,wr—W-WWmn,mu~.-—W«m.mnmw,-.~ aw ﬁwru "7‘ a-r-nrw u-vmuw-u-n you-.— Max Fiﬁ-c, M.D. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Thomson, Louise Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-300 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8adfad8fe0611e05802ec89714b84840.pdf 65ef262f8c5664ea654fd3d3fbf4ad11 PDF Text Text May 23. 1966 Hem C. Dunbar Strut Wards Dr. State Hospital Matty: 600 E. 125th New Inland York, New York 10035 Dearﬂy, Aslhawdismood,lmuldbem’cgmtefulformopportmity tomymmfwiutyformmoomingofmmsomtlom oontinmapmlinﬂm mlyais bogminﬂisaouri. ‘Ihepzojootis a mmophysiologioal evaluation of oyclmoim, a now narcotic antagonist. Ihavoalmadymmaoutctrialsinoohiwphmio pationtsmdwouldmwlikoto-‘mkomminamoftm addicts at of the Hospital. A is attached. W. mum mom». Dimudm've W protocol copy both givon their appmval. Forewofﬁnpatientsmalnadyhmaﬁtypemissim for the administration of oyolmomo and copies of those can be made availablotoyouifyouwish. Ihavo ”mm. Solvartzm sendto of your responsibility -» for we will aooopt you a blowout full mapomib -ty for-tho smdioa in your laboratory, as well as the to and ﬂux: mttopolitm Ibspital. As I have Minted. we will ask one of your tool‘nicims to assist us in that records . we will memento her at an hourly mm to be set by you. Win: ml Ilodcfozwardtoﬁxisstudyehdlammot gutoful fortho which possibility you an affording on during this maiden. Sinoomly yours , Max Fink, H.123. meossor of Psychiatry MF:kp oc: Dr. Freedman Dr. Sharoff Mr. Wm � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Denber, Herman C. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-301 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a9fc124638d6b86c537ed07677015b16.pdf d50d95ae8e05c6d1bc0a574f64af33f4 PDF Text Text May Dr. 102 ﬂounder M. helical 23, 1966 Don Towers Jeppe Street Jaimesburg. scum Africa Deaeryn' I mfmmmaddmeeﬂnatymhavemkenmmt minim seem to be an. mice situation. 130k. and good are at mm“ welm‘tim of eyelmnine this it of WW reported. ﬂmmim denature mumbeingmlewmmmnbemimminm here The completed an high speed. going and 311116108 and We have ram being In addition, undertaken a m analysis W. that I leaving, W1. mm.W,Alimddewnwillbeabletemlete IhOpethat early of 312-155 and these males we have New am (ha-1m the next half year. I amiaaving for New Your}: and «new in mid—June,SﬁnAveme mmsmmmmmymmmmm. York. at 106th Street. ank. 10029. New ms Wis the established for me Mew any relationshiys mid: have already been the appointment as Clinieal Dimter far themntalﬂealthmn‘ter. 'Ihiawillenablememdewlopduniaal redeem-n pregnant in the 100 bed own-Patina: Bazaar-tum. institution as Ofmvwimsdmgemich have well an in the been studied, ﬁniuthim mwbeﬂnemtpatmtefﬁnemwpeydmpicdwm fluphenazina dewmte whim is a lung acting a wanderful additimal tool in the schizophrenies. trumnt Wham, Main of Hermvebeweblemdismseanunberof thammﬂﬁsmmmmmmmtmoemwbemh 'miwtmmwngﬂmmtotakeﬁmirmdicatimmmirm. One of the me {Damned is in mm addiction and w wehawnwbemmstwieeefammmticenmimcalled cyclemcim. Me Me been of great interest mnd I have unwted, because of its mmuphysiologieel wafﬂe. that it be tried as an *7 antidepmseant. �La». -2.- A. Dan May 23. 1965 matings, mam your qmstiona meaning the amt aimeIluwnotbeanattendingmmrthapastyearanddomt I ECDEU plantodoaointhefutm. Pamapsmtimewithinthemxtyw, we will apply to Mama an offiaial ECDE Unit and may at that time begin to attend these matings min. The girls have mntimed their intmst in dancing and we mploasedtobeablamtakaﬂmtonYorkwhemmthink their training might ha maimed. Martha joins me in sending you and Batty ear best regards. Sincamly yours . ' Mf‘zjwh m M, Nd). I’m-femur of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Don, Alexander M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-302 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/ca687a22612e6a27edf573dfa7b36fe4.pdf 491852bb915f0aada029ee8e8bcd7a65 PDF Text Text May m. A. J. Associate Squibb Nu 23, 1966 Sammignc Meal mum Institute hr Medical Research Wok. New Jersey Boar Alain, Idid mamiwmmmtofmmappoimmnt at the New York Medical College. The letter when was waiting far In I arrived last Wacky. at Squibb, but I did so Latin this opportmitytomngntulamyoumdtoMpe that your nw positicn will provide you with the opportmity you takes Sinaamly yours, 'L—w-vﬁrmww;‘wavwvn‘yv'mwr.¢wn7lw'a'w‘w'm ..-_A -‘.x —w *»'r’H—n-‘xﬂ'ﬂr'r~.-' ﬂax Pink, M.D. Professor of Paymiatry ﬁnkp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Sanseigne, A. J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-303 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/236c9147836d463c0260a39085b5eda4.pdf 24f805399b185cf4c68fb29f1c8ca04d PDF Text Text May 23, 1955 Director of minim). Research Assistantmm, Jd‘n H. HOD. Inc. BMW-Wm, 120 south manna Stunt Chicago. Illinois mar mm: 11-. 60603 m far yaw Thank you may me}: midmtim in amding an the mlm "Paywaanwmaand Sawﬂzapham” edited by 1». 0315.11. I have interact. this with be wt ‘ Hayltakeﬂaismunitytoindicamﬂutlwiu about NM 1 take 8t. my new position- having Wis to up as meaasw of Paychiatry at the New Yea): Medical Collage. In this position I lack forward to davaloping clinical similavtoﬂmemichmhavam rtakan gampmm wmmofmmﬂwinbe: Wt of Paydmiam New York Medical New York, Fifth Mama at 106th The reports ofthe New Strut Yerk 10629 drug study pmmvam mm for which I haw accepted mum. mamibility will ”any be mhtad this Oopias now being - and them summer. willbesmttaymaaaomasthaymavaimle. Thmk you for yam:- enumeration. Simmly yam. m MP: ﬁzz-h Fink, NJ). Professor of Paydaiatxy � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: McGrath, John M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-304 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/964446d201f4dbafb71272225bb3e8ae.pdf c6ae689bba1a52f76096e657031007ed PDF Text Text May 25 , vmt mm, J». Associate Director Dr” Yo WtWat I Why ﬂ of Clinical (has. Pfizer 3 Dow, Inc. Grotcn, 1966 ‘ 063% Door Vince, have computed the shady period on our miothim patients am lowing Missouri for New York. We have studied sixteen patimto sinco January. may have boon on mdicatim for pcriodo to fmmumﬂxo. Anmoftlmpatiento have been We just as I fmfmmka disctwrgcdaovorymchinpmvcd.whilcoﬁ1crshmomwly inpmvcmnt and than a relapse a littlc bit later. In general, very pleased with the clinical effects of this mama and it is the amical opinion of my staff that it is an effective psychotropic agent. we have been The is now completed and we havc begun pm oftmmingsccles, laboratory data, and data oollcotim WWMM will prepare. a written report. 'lhis four weeks. In our mpmvt to you, we 81101le be will send available within descriptims, rating scales. Is them you case omieacfthclabomtorydata,gmphooftmdoocmsas and samples of mm given to the patients, mything also tint you mild like? We have generally not wialmd tofillwtfoxm airmmthwghttrntthodatapmaantation mthoda has using been our cm satisfactory. Hmovor, gammlly ifthcm isaspecial foxmtlmtymmuldpmfcramusing, lot on lam. Thom am camber of patients who are continuing thiothim and I believe the plume on laboratories mnld need additional oupplioainﬂnfutumtcsustainmpaticntowmmon to file an additional mom set and I will arrange for continued mdicatim. If it is Wodgatcv farm, please sand me a. mofmymiatcawhoiomininginSt.lrmistoacccpttm clinical I time, responsibility. will, at that remaining supplies to his cam. transfer all Effective Juno 1, I will be leaving St. Louis, altlmgh I mm for a umber of consultations in order to mute bothtl'ziomdotmrstudypmjects. Wmaddmsswillbethc New plan to Department Amm, of Psychiatry, New York, New York York 10029. radical college, 106th and Fifth �may" «7"— “:vf' “Wu-y, 4—we- ‘"rwww .i n.1v v Raw—I'm -‘~r'ﬂwﬁvm"‘*‘m‘ﬂnm Dr. manta ~2- May ‘25, 1956 Clinical facilities are available at the Metropolitan Hospital Omar and I look forward to establishing; a clinical facility similar to that which I establishad in St. Innis. The populatims then m mm mm mad include a large out-patient Wt. has been most My mm I look imam to continuing plusmt. ‘ our collaWtim which ’ best mgu'ds. Sinoamly yams, Max Fink, Md). I’mfesm of Paydmiatry 1‘1?sz � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cremata Jr., Vincent Y. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-305 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/b650ded05c186906aecd8f3eea904342.pdf 6b738eea78eccba31da3184a0884c95b PDF Text Text May 25, 1966 at may We of Wtmimity Meal Dr. Barbara Fish Profeeeov Psychiatry md Net-mom York York University Selml 550 First Avenue New York, New York 10018 New New center of thdieim WW. ImplemedtomdyweoopyofﬁxemportMyou by as “6&va and “em Mme and mummminute“ Amm—Wmmimmm mwemd -~ ~~ wiﬂﬁnﬁmmxtfmmﬁw mislnebemmoldlmofmmitﬂwmmat pleeeumtopmeentthiamtemlﬁaiem.1haveoolloetod mmmmdmforetlmtemmdmﬁlethepeychiemo profesaim has become increasingly involved with Wrolamime, mtylelnlim has genermy been forgotten. I think it is m element in ﬁle names system and especially in mm Wt pmeentmezmmtmthode I look regards. I'm to seeing you again in New York. My best Sincerely youm , ﬁnk, m meeeeor' of Psyemetzy HOD- � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Fish, Barbara Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-306 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/7947246904a1ab6b7908260974dc06f0.pdf 824bd72f6d4563b322b92cfd72c759ac PDF Text Text �Ir. mum it In to have that I have to ear one-workers War in oi. the staff desigmted WW India. 31:. The imminent in this we” has been high and we are wondering if you would «cw-widen an additional atudy. For the past two years we have carried out an intensive. investigation of a may or therapy teaiatant peyomtiea. It was heoauee a manner ~«-mm~«.v wpv w“. w,— . amt failed to take their madioat‘lm that we the wolixin automate. more one approximately 16 patients in the discluzad gxoup from an! original atmly mmﬂon. of this group, the majority are meivlm butanerazim daily. We would wider the gradual transfer m (Wru-V‘wn-v-V‘V'P‘I'V‘F -, ﬂay 27. 1966 ~2~ 1 We and to eontimxe the many in order to provide newline inmtigatw mlnlamtion of .Pmlixz'm deoawate to ﬂame patients who already have mam? If so, mold you please wand he the eppeopriate fem ardiwlll mngetohave‘dmaimdarosuhmittedtoyou. I will, at that time, two over all the woollen of Pmlixin an rm .,-,-A,.,,.r—. ' ol'theaapatiemfmadailymleedleetiontemuxinonm thee mite-patient heels. and than to Mlixin deeamete, twofee lfeuohaatudywouldheefintemattcmlahmwiw. _Iaeplmadtotenmthatloanlethoeetwlinh clinical facilities for the evaluation of new We at me Metropolitan Hospital Center in New Yong. Thin facility is part of the Depwomt of Psychiatry at the New Medical College, and the We pen-dams” well as tin utwtlent Bowman: lam-I to the kind of irmetigatiom mice: we have in 3t. Louis. I look foamed to continuing my mlatimhip with 11m: and withmv. dame-{gm the new kind enough ka mum mum to call me last week Thank you ,vv . wee again foo your connotation. .......... ”a... _ Slowly in“... Fink, PhD. m Etofeesor of Psychiatry -W.,‘4W‘nM.-'l77“"17”—-‘.ar'7“I-"n<-."<P' .. ». m. mzjteh do: I‘m. A. J. Sameigne Mediate Medina]. 13.1mm» . Squibb New _ Institute fw Medical Wick. haw Jamey Research: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Monroe, John F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-307 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/be4494adbcfbdabe81d9069dd77f65c0.pdf c1f5b53c8de3ac7919349741d562b099 PDF Text Text m .,. fwm‘ in...“ » ‘-'Jvau‘.-' sumvar‘v'iF’W-n-v-z w:- May Sumter 31, 1966 W9.0. F. Mendy Washington. WWW: mmtmofmtympmiowithmsueto mammayhesledemoflegieletoreto Wmmmmfortheetwyofﬁuismmd. Pollotdnsthempepermporte.1uwitinstoomwudm moﬂmetemmwmmepmblmof moaneofmmmde Sims 1953, in everictyotolinioel mmmphysiologiosl studios. Wimhmmofmymmmteloamme wroee mleintlntmetnntofthemtellyillhmbemstmiedin endmeeour-i iﬁDmoeenminterestinsWudwithm arises effects, and value mmmxmnwmmomwmmmrm recently its specific emetic in peﬁwtshesbeendeeoribed. “Wofemeoiﬂmptmio Inmemdies,ﬂwe6dnismtimofmnmremdmm mm: ormmmlieetedinitsmtﬁmmyofm Indeed,intheeeme mtellyillithesepfpemdtobemmllyeefe. HemoentIy minus ofimindommusingfmonetofivesmperkilom (lee-sou gm) end noted that om subjects tolerated these very well. The mly untoward effect observed reviewed our with single and mltiple edeinieﬁetim WWW heebemspsolmgedreactionofiammsedpsyototicquelity, mdthiehesbeuuobsmintiminetmoee. ”meinoidmoe ofpmlmaedmotiminthiepopuletimieleseﬁmn. Despitetherisksirmlvedmdmeppsrmtlsokof specifiothempeutiomlioetime.tointsmictfurther shﬂyofthismomdwouldprwideedmgemxspnoedent. Inlebomtory-inmtisetime, eveihhleinmedioelmeermomtere,tmlikelihoodof mmmuMy emeiemll.1woulderse.tmfm,thetyouandymm Wits. omtimmizmstisetimsmdﬂuteveryeffort �senator Kannada! 42- May W. not to dowels}: blanket curtailing of studies of this, other hallucinogenic or experimental be: made 939 31. 1966 in the press «mm m you mm Dr. Dr. Wing WMO. mm dma web to Wmmt experimntal mam. Wm mmible mammptmmmmum support health position with mm to this difficult mimic faryqumted pmhlem. lucid-murky. tho SW1)! yam . Mm: Myxjwh Fink. H.123. mem of Psymiatzy � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Kennedy, Robert F. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-308 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/f2653ab113c0003085b06f370ec47d35.pdf 7251891bc84590465f6b126853085285 PDF Text Text Hay 31, 1966 Wendell R. Lipton-rt, 24.1). Chief of Research State Hospital WmCslifmxia Tame. 95%]. W Dr. Lipsm: ---of reprints which describe m are a inthselscm-c— ofwwsmtmmrdingmm” with The drugs. bibliography W m Wmie of whim you speak is Oumalmt 23 of the and mum be available in your library. EEG Jamaal, .Peﬁnpslwﬁldbeofmmhslpmyouifyouwmld www.mmammm ledtoymmintsmt inthe elmtmmphslogxw. it has been opinion for my my years mat each of ﬁre peyamnwie drum are effective mﬁmextmtmtm‘alwmsmmelwtmand that in time patients in these WWis m mange do not occur. the therapeutic results are manually most calm with depmsim ma mcimphmnic year. This those receiving not only drug therapies patients, but other somatic: therapies as wall. ”My It has also become very clear that psychotropic drugs hallucimgmic agents each have gate specific aims Warmth eimtumpmvidoanadditimalmyinalmsifyingdmgs and in the and bummed EEG pattern changes. their effects. I met this is helpful, and: questions. feel free to smite to College, 196th and 5th The if you have any more me at the AW, ﬂew York. specific York Medical MYork 10029. New: Sincerely yams, Fink. I'LD. Professor 915' Psychiatry Max Mdeh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lipscomb, Wendell R. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-309 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/d260e3fedbf2a9bf41dcd0d2888748a0.pdf fc646fe8d9c643147025f3c1dc394692 PDF Text Text my 31, Wt W: Gnu: 101 01:! 19-68 Company CommRoad M m. m: WWImintMpoaitimoioquiwmam and m midermg your aquimt. I hm. 2»th available the whiaxyou dimibutad More ofW3 the Naming my? find Wpticm W ofthoﬂodal Imldbcmufulfwmm and 78 Polygraph. of tho various mm prion 11m and Wordptim Wmldyoukindlyamﬂthio memtm. Mimi intonation to Kw York -. Nu Yak, Now ‘- “—2.2“;TJA' My uqmacwwuy best my now address at tho Gallows. 106th York, 10029. mm. Wt AW, Strut at Fifth of Psychiatry. Simmly mm, imam" 3‘11. Max in! "'1 ,._ rzmrz'un «:0: 3‘31"“ 2%" war-“v“ «ravens WIQFMWMW‘MXVLM¥W n 7 r mjm Fink. PM). manor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Grass Instrument Company Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-310 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/fb0f3dc4bd989856d75a62e260871b9b.pdf d9d71513f021c39df061bdad676d546d PDF Text Text , ‘ .._...., v .. my, . v . ., ”‘Wywrw r. rmijwq... m-ﬂwl‘v'l-"Wﬂl awn... WM... . . v.r.--.-.rwm~-.-...y~yam—"w “W”... ...W. 1.7..w -—"-~1h~. u—wa—Mrv -‘_.. WWW. "um—m ...,....—,.-..._.. 7.7““ -wMW—N _ . "my. 4A,...wm. w”- <... thy 31, 1986 mwmmmvwww_ Ratimnl Clearing Home 0'! Mental Health Information m. new, 14un 2091» mm Gomlmm mm*mmmmmmem»"muy mimwmmlimﬁr. 12;»me “Immumtofulifmymmummmtomm that ithwmablcformminthefbldofmdum mm: you for your Wm. Simuly yours, nvwmgmmwwrmm—vrwww—«m".w—m—ww‘xm Hm: Fink, Md). meosaor of Psychiatry mew-mm --.»-‘—v—v m ywn- ~1-W'wlwwr‘.'w . .-» .— man-purvmnvwwm-‘ -n V. .7- � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Information Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-311 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0c257acc80a24476de3883f292b07bd7.pdf d75fc033ba4b52fa712e243a57252088 PDF Text Text May 31, 1966 J . Sanseigne Squibb Institute fer Medical Research m. A. Associate radical Dimetor New Brunswick, Haw - Jammy Dear Alan: Emlosed is a carbon of a lattur which I haw: sent to Dr. 119nm describing the pmsent state of our study progmm. Siam I do mt law the pmpw 13110130001, it seemed to write dimatly to him and send you the enclosed muting that ha will «plain the apadal mlationship that m have eatabliahed. Wan cam, My best mam. Sincerely yours , ﬂax Fink, 24.1). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Sanseigne, A. J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-312 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/843152d075177b654f40b770c49e78b8.pdf 5db02394c9e1e50a81d25da24828dac2 PDF Text Text 31, 1966 May Dr. Nathan Siege}. Neticmal Institutes of Mental Health Bethesda, Deer Net: mm . have received the request which I have signed, but believe in if you cum. The authors did not tell are you amud send Where t9 return the form, but fortwmtely I saved the outside Departht mummy of 1mm, melape and is to go to the Iowa City, 1m, 522110. of Sodomy and Anthropology, I it it new I have efficially address is: md to New Yam: Medical college, and w “nt of Peydzia-txy Mien). College Fifth Amm at 106th Street men next yeti-9m in New York New York. New Yam, give New York 10029 me a ring. My best regards. Sineemly yours, Fink. PM). Professor of Peychiatzy Max 91?:th � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Siegel, Nathan Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-313 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/3ec7475369f465cb6ca80a4d0d394eb9.pdf 70d0b53748a96e1e4f41f7b728a25300 PDF Text Text _- May 31, 1966 rww—Hu—u-Twﬁﬁw'wr'li‘v a...“ Jr. : .r v v- zmm— Dr. H. A. Robinson Psychiatric Institita University of Maryland school of 29 S. Groom Street Baltimre, Maryland Maine 212 01 Dear Dr. Robinam: Emlowd are the galley proofs and the original manuscript of the report ”(holinorgic Aspects of Comrulsive 'I’narapy." Please note that my new addmss. affective Jme 1, will be: Department of Psychiatry York Modioal Collega Avenue at 106th Street New York, Now York 10029 New Fifth In such a review, I have attempted to smrmarizo the conclusions from each section by a paragraph at the and. In my original mnusoript, those sumary paragraphs were italicized. 'ma aditor has profound not to italicize than and I will agree that this is should be publismd. I would feel better about if the way you have had a clams to'mviawtha gallaya and make yourom decision. If the paragraphs are not to be italicized, please cross out the right-hand 'maokats and the asterisks beginning on galley pages 1%, 5, 6 and 7. it it awry Thank you for your cooperation. Sincemly yams, Fink, PLD. Professor of Psychiatry Max � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Robinson, H. A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-314 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/75e4a536790ab1164ed50f51a7d16a90.pdf 2dbd0c59c5e79c5f5fcc088475481447 PDF Text Text May 31, 1966 W War Dean admits! Magma Linden and Skimmr Cumuter 6mm? St. Innis, Missouri 33130 Dear Rich. Dmmyhewmldymﬁmtmmplummgtowtona mmﬁmofmofmlimmmmmetthe forthcoming world Cmgxees ofPfsyohiminMdﬁd. Iwill momdieke. Itaveoalledmhmdmywilldotheirhest tomﬂmemileblehymmofthenmthformspecm purpose. Ifthedisksmdpmgrmmavaileblebyﬂmfimt weekinJuly,IomamgetohevethunmippedfmmeYoﬂc vim manurequiment going to trample Congress. Please omﬂm the rental of tuna disks for approximately a four worm: period and charge to the Wiwmity of Missouri. Many 1mm. sincerely yams , Mex Firm. PM). Professor of Psychiatry Mf’ﬂcp � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Dammkoehler, Richard Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-315 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/162cb1df8cd559023783b0d4fb2d60ff.pdf bebb5bc2386d3bc8fd7421b696cc4858 PDF Text Text May 31, 1966 W, M“ A. Editor-WPsychiatry DP. Waive am What Amm, warm D. C. NM. M Mm, Sommntheego.meuhmittedemportWicStudies V Petimta" forwooneidemtim m inWReeietmt for Compter 943W. Wehevemtyetheamfmymm offieeemluouldbemtemwrmymfcmﬁmthetmmmke a « eveihbletom. ImleevizmeWiethieweekandwnewaddmeewﬂlbe: Departmnt of Psychiatry New York Hedieel College Fifth Am at 106th Street New York, New York 10029 lutemeroftheetaff at St. Vincent's lestweekendmhdieeted ﬂatymhedbmeppointed Incidentally. Hospital that hospital. WWW! Ihope Wafﬂewehfor ﬁattmeiemwmdlloekfozwmmeoeingyouetﬂmmany mtingamich‘tmpleeeinﬁwYorkinﬁmfmﬂmingyw-s. My best regards. Sincerely yams, Hex Fink, 14.1). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freyhan, Fritz A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-316 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/1263fc68bc59217f86c94b691f64ba21.pdf 8bc686d6dba51a29e1153dd8fbd084f2 PDF Text Text My 31, 1968 13:». Ely RR Ivan Emmett Lillymd WY 2.8% 18. Box Indianapolis, Indiana Ivan. mmofwattﬂinowimowlmiofimllyming momma, mmmmmmm,mmpmmaﬂy mmmmmqmmwmmmmmmamw typodmdooopywillbamtocwuamly. for its effects indooholicc Boyouhow any infmmtim available amwmitmmmiamdtmmlyormiomy inﬁnmmmtofmliom? Inﬁnmmtofmmloaio. Mommmmympoma dental mammawmmommmof Immmmmfcrmmiaminmingmo hmidmmly.lmlmm8t.1wiomﬁwﬁm qmatims mkomemdwmmwillbe: Now York Modicol College Fifth Amos at New 11:61:11 SW1: York, ﬂaw York 10029 Asinmaoaoointiminmssowi,llockfwmtcm mnﬁmndoollabomtimfrmﬁnolinioalfacilitieoatﬁm MYoxkhdical Gallop Hatropolitm Hospital Mica}. Cotter. -— Hy host mm. famously yum. Moo Pink. 14.1). Mom of Winn? Wzlcp cc: Dr. Itil � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Bennett, Ivan Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-317 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8c0d5614a7893317553d0654bbfc592f.pdf cb298f40c6077e0c787431d7ed957991 PDF Text Text May Dr. Heinz E. Clinieel 31, 1966 W Dimm Dmglea Hospital 6875 Walla Verdm, Quebec DeerPhinz, Smmkaegoywmkimwmmempyofm Wmmvmehymgawetmcmi’inumhm m.Alfmdﬂ.Pmemn. khhasmfu‘mdthismpcrttom,end Irmmditwithinmst. Imtmtekeﬁﬁacpportmity mhiebehelfmdwm,tothetﬂcymformingﬂﬁstow. and an mm We is: Imidmtally, I have left Hedicel Collage. My new Wt new at the New York of Paydmietxv New York medical College New York, Firm Amaze at 106th Street At this Center, I the clinical York 10029 :38me mm. m and which have Hy New thﬂt I will be able to m~establiah which ngen in New York, prom an well in Imps: best regards. SW13; yours, Fink, 2m. Professor of Psychiatry Mex 1‘1?sz ‘ � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Lehmann, Heinz E. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-318 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8b0db999be6585cfbfe3e1c71ece407d.pdf 665ccfa5463134430e34ceb72c2f0fd5 PDF Text Text ‘ ,4 _,_ ....<,‘ May I -, ‘ 31 , 1966 ,A , A .;-_-.v...-.-.,V. an «53- Raymwd C. Posse, 11.1). Medical Director .n, "Friar-m4- 5"“de Downy Laboratmdaa Box 1113 Lincoln, Nebraska 6850]. Dow Ely: ”WW-mm‘wv Thank you awkw- arm-n for your letter of your suggestion, all have been dostmyed. , available Wm ﬂay 28, 1966. mplies of Following Shmmly yum, if'ﬂ-‘K—J awn-wan»; saw Mu Fink, reg-"4'," vamrrwt-W v t gm — magi-mu; ray—urn "a . ma "tiﬂmmwwﬂ'wrvmazwa"?7§‘?h’-v:.,;;’:»q.u 7: "Iva-ﬁwrgym et.»- My!“WmEJAW£Ww¢mmwmggmr .- ‘1)??5‘75 fojnh 24.x). Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Pogge, Raymond C. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-319 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/e13f80cc38ddb10578b63cfbd6280a11.pdf f46ecc43d2ccbef280c3a72d7cd3ba20 PDF Text Text my 31. 1966 Dr. Joel Elkee Chaim and Professor of i’syohiatry 133th of Psychiatry Jaime Hopkins university 3%]. of Maine Baltimore. Dew Mime Joel: It was kind of you to diemme my report at the American Psychiau‘io Association. Owe again, I an in your debt for your special ability to place this etudy in its: historical omtext I very mach enjoyed yew reference to a spiral, for indeed, history seems to repeat itself, and yet, each step carries no and the history of our science a little bit forward. we hope it is imam, am! that our untributiom mybeofemehelpinmvmingmrsoieme. You nine were kind mm to invite my participation at a forthcoming mating in October. WWely, I did not take a specific note of the datee and I am writing to request your confirmation of that hwitation so that I can mice the Weary plane. Dr. Freeman has asked smother I will be free to join him at the forthcoming Feymiatrio mouth Society Meeting in Pele Alto. am I am also hoping tobeabletoeubmtahetmoteattmmmrioanmaand American Society meeting-e Would yw, Wiologioal confirm the dates inwlved no that I can set Wm, them aside. Incidentally. effective thin date. my new «sateen will be: of Psymiatry Inme York Medical College New Fifth New Avenue York, at 106th Street New York W best regards. Sincerely Fink, PM). Professor of Psychiatry Max MI”:jnh yam, � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Elkes, Joel Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-320 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/ab753a37ec263df5a676a8298fa6559c.pdf e11e8011111a92808e663cd2ccfa4f66 PDF Text Text May 33.. 196-6 n4 w 211”". no nvrfw-u ., g Wm ”mm m hummmmzmm National Bark 391': WmMmth-Wntmofmpt to Mauve ”Win with W m raw gmpmetagta! AME ‘ ” - . logy Pa Emu yours, ﬂax Pink, 14.x). Manner of Fwd-dam Wakp an: m. 11:11 � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Jonathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-321 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/27f9c7daae96f2c09960c9ac290c3266.pdf 2d3da35543957c1d06d5af5c4f923c71 PDF Text Text May 31, 1935 Miss Dorm la Rock Sanders World Travel, Inc. 925 SMreham Building 808 15th Street, N.w. washington, D. c. 20005 wruasum: prefer not taking the day train to Inningved, since that will shorten our visit to Noam. Instead of. the night train. is it possible to arrange for a flight in the early evening to Leningrad and a stay at a Leningrad hotel? That would be preferable. It would be helpful if you would submit a statement of the expenses for my trip We would fmSt. WistMBmwandmtumsothatI cannahethe necessary arrangements with the University cf Missouri. An I indicated in our teleplwne omversation, the statement should imlude all the costs in meow and Inningmd, visa fees, and rwnd trip mmportation, including St. InnisNw Yorkw-St. 10%. Thank you. Sincerely yours , Fink, PhD. Professor of Psychiatry Max Mszrrh � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Sanders World Travel Inc., Donna La Rock Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-322 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/4ea36104058a009c44093b0904f4d881.pdf 29c33d61d43d4d2926ad71001a9f9307 PDF Text Text A May Dr. Alfred Chaim. M. W 81, 1966 Com-mar Ooamittoe Yeti: Medial (blaze Fifth Avenue at 106th 8W1: New York, New York 10029 New mm... Follawing your Wtime, I have recently prepared an appliceﬁmfmemmrwmntmichiebeingemttedtotm Public Health Service EEG entitled ”Quantitative Studies in PsychoThat applicatim pmvides for the 'm-eetablismmt Way.” inbiewYerkofﬁndigitalmmterbasedumlyeeeoftMelecm~ mam ermpheloy-em mick“: has been explored in for the past four were. At the present time, the equipment in St. [axis is based on an m»: 1828 amtrel and the mtnllatim is deawibed m an IBM-1710 emtml system. pm Inmiadngﬁefmilitiee ettlnﬂew‘lommdicalmnega “mmtmyepplicetim fw‘mequipsmwﬂlmyeminimm ofetmmrdelivewdehy, mapplimtimpmidesforthe 1820 by the specific components mutiny:to of the available it ta e 1710 system. The mimetic»: requests mm wfwemyeerperiodwiﬁzmis eystem, endthmmup» W Mmmmmm. Attedud are copies of the specificatim far the four mafiatime ma mique pieces of equipnent mammary to magma-at the IBM 1620 Mm York . me fma;t. Innis. Radial Gollege. me specifications are those taken Imuldbemtefulifywmldamdampyeftheeespecifiea. timewithtmoollege Welteﬂmelﬁdmpneentativa, Hr. 3116mm, at 220 meme Nw‘fozk City. I balm it Robert muldbe eppmprieteﬁntymindimmtthiaequimmtwinbemqmmd 1. «9.30mean pmidedttatthefmdeemmde mmwepplicetim. * aveilebleinW �Dr. Madman Secmdly, Output-er ~2- May be grateful if you would review with the and the offioors‘ of the Center the to utilize tha basic 1620 for a minirmn an I mid WW possibility of mm 31, 1966 War Wt Aslindieatedinmy periodofappmximtnlyarnmdaily. of April 29, I would be mteful if the facility could availabla to the EEG pmject prom daily fmm p.111. to frm to“ Mt aakthatnomntaleostbeimmedforthis timbytheEEGpmgrm is this prom ha made M and Satmﬁay and Suway 8 mm. pan. I would and that the equipmnt which named under will be Center far other users at other times. available to the WW Ibaliawitis almappmpriamthatmindicateﬂuttmm will movida the mm). for its operatimw prom during than hours it utilims. Thank you for yew assistame . Sincerely yams, Max . M'Ftkp cc: Mr. 1min Samar-tn Fink, Md). Professor of Psymiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Freedman, Alfred M. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-323 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c232347305963a7f214321c3f56a11dd.pdf 4f64f32979520c65c08e62ad448eceac PDF Text Text nay 31, 1966 Mr. Remand Cam}. commuter Centw York Mien). College New Fifth AW at 106th Street Yuk, New York Res-2 Dear Bernie: mqueeted that I swine we study prom in single page. The best enemas-y is the am that I rave recently prepared for wenmtim at the mm Congress of Psychiatry. A new is fee yum use. You as W em. W wﬂlbemsolwdatmenextmtingefthemer I have the hope M t.s,_.... withthe wplimtion to the NIH}! in netwewiu be able to have adequate time set aside for studies I indicated the sense «of we discussions to Dr. and trust that this Osmium. Iheveeleeellledw. Shem.andwesmeesured byhimﬂatﬁmlﬂOsﬁshtbemilahleetmtimwe He has Mice-ted need that he weld like a letter it. tree the Galley! so that he could pm the neeeeewy cream. especially for the was printer. I have smitten to Dr. asking that he make the neeessar'y memements with the eutlmrities et the college. includim muesli”, so that the cadet for the 1710 and the less amid be entered new (subject, of We, to later A copy eermllstion if the pant is not espreved). of my note to him is massed far your information. I will mt be at the. college this week, but may be in again at the end at the next I will take the opportunity Wm '1 5:: "Marv-Irvvmhwﬁ temuyouendmdetemire mesmtstamsofm epplieeticxe. w- Sincerely yams, wwxn‘n‘w‘ﬂwr- Max HF: jmh ﬁnk, 14.1). E‘rofeseor of Peydliatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Carol, Bernard Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-324 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/dfe3a2bfea5a520f1fbcbf827c85da98.pdf 9aae59c5d8368859308cbc05f48df72b PDF Text Text My 31, 1966 Mom. WeiStmdam mum Wirﬂaor locks, mmiwt Mr. Boar Jerry: I It was a plenum :9th mviowing your extensive data analysis. to ﬁt. Louis and Don Shapim and I haw; had an opportunity to review your game, the otrip chart playimck, mum and tho of the period analysis on the same The following «amounts: are housed on tibia mviow. 3mm record. Examinim the power graphs. it is clear that the major changes oboowod in tho strip am momma in the man, nominally in the thirty-om spews. Homvar. mob of the who reflects an of energy in the very low fmquunoy ram (0-«2 ops). In the mual spatial amlyois using the m,- Walter MM“: balm mm cycles per oaoond am ammonia}. than the If m 45.0mm the 1%!” and very similar to what we had been is quits: using,- tho Grey waiter typo analyzer. The am aloe similar to what we ham observed 5m mprmmtim tho period mlysis program. Because the out-put is in graphic form and not in nwaerio, we more Mia to mice any specific ominous of the M“ um did in any fmqmnoy band for the two grously and fomd that me am Wm wt W MWeo MW, mm mm film, Marion um um, beam samples were parallel for your mmtatiom Mommtatim and ow period analysis. It is ulnar that tho a momatim of expel-jaunt. this M It sum to will method which you oranges are utilizing warning in this pmmts mama that the applications of Wm. largely on its stability dogwood you have MW), its mama. ease of handling, “so of forming of output. We are mamas: about (mick and no, tm the approximate figum given that ouch sample requires about four wanton for analysis. Mia it my be feasible to I‘m-avid: digital output, surely this will be an ammiw addition to the instrument. The. question is largely an 0 �Mr. Menthol ' +2- ' May 31., 1955 anemic om. for us, given the opportunity to utilize a digital motor. we believe that its ﬂexibility and me variety of analyses and applications mich it permits superior to an analog inetrment, even of thin oleenetttmpmenttine. Movemifonewemto require er: mics; device for power epectrel analysis, the representations which yon have given no are equivalent to those provided by the they Walter and hf; our own digital motor methods, at least in the greenest outlines within the limits of the outlaws which we have applied to the convinces. would be . I have very mach enjoyed the opportunity to discuss momjectammrevinwﬂndatamimyoulmveeuhmted If them is any additional information or assist-awe met I om provide. please do mt hesime to call on me. As you low, W1 transfer to the New York College will be amplete Jtme and be reached abort I can 13, 1966, at that (lioness thereafter. my Sincerely yours, , w. e. .. Max - g 5.6:...“ ., «m .y-yrIVX—vrqlmw. , . ~ 'wu’a‘n‘z: Mszah P.S. Fink, NJ). Pmtesoor of Paydmiatry _, Inntakingtrelibertyofattachihgaoetofcrimia whiohmnetupaoamultofminquiryfmnmmwll Aircraft Momtlmelmnteofaeystoninmﬁoh wenwldbointsmnted. � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Rosenthal, Gerald Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-325 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5a1884cd67b25470dfc6a241090a9200.pdf 3a3ca1e14dca4ff4161b8680ec7c9fdf PDF Text Text 31, 1966 May T. P. S. mitts, P. 0. Ben Deer” Paddy: Yonkers, M.D. Ii313 New York 10702 I msmitingtehringyeuuptodateonthepmeent status of set study sf ST-155. During the past few weeks, treatment with mass has been instituted in five patients. In the first two, the EEG. erminetim were dam follwhg the pmtoesl end we were able to see. at the dosages given, no signifiemt es in the emwemmlegm Fer thisneessn,we. fewer iedtheprﬂmlsothetatpmsent ST~155 indosageethetereixmesingeptosodgmperdey. of May patients are remixing daily echdnismtims of 27,1966. feur ef the patients are maintained es indossgesbstmenltsowawocgm In use patient, the easement developmnt of an inflamtiovefeveineftlnlsgwimodmledtoour diseantiming e11 Wineries. This represmted for this petimt of an earlier 111m” and a because sf my direct militias ts ST~155 but it was net of 3mm pretentious that we dissentinued the manned. Incidentally, this patient had begun to refuse toestsndbm minglywiﬁxdrmmintlwfwdeys before the sedieetien was dissentinmd. Both these westerns semd to mnmte in the days after chug widadmwal, mums . We butthesemeysleehavehunmlstedtemimpmmt in her W effects midi mm). rendition. The behavioral as the thrmhosis improved have been renamed to date are quite smell, representing primarily as decrease in enter activity and an increase in sleepiness and withdrawal. Asymlnww.1willheleeving$t. Wessefdunela, My associates. Dre.i(es1cinsr. Sim and Itil, will, hmver,cmtinuemisstudyend1plmtorsturnetmmd ofthemnthmrdeenftmthsreeftsresmeybeneeessarytomntime 1966. the colleboretien and consultation in this and other studies �Dr. Watts «.2- May 31, 1955 are not yet mm make available convicted. I anticipate that we will be able the usual sumary of our observations and of to the variety of laboratory data and rating scale information which may make this evaluation helpful. 'I'nankyouonoaagainforyourkindnoas duringourmoent lmoheon. and I look forward to starting with you soon. Sincerely yours . Mfzjmh Fink, 21.0. m Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Watts, T.P.S. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-5-326 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/da6a55db7c12bcdcb1232c58cf8ea3ac.pdf 03ceeab5088764d1b4076f318db82534 PDF Text Text Jam 6, 1966 w.ikru1dE.Himmh www.mmmm mmwmwm Mann-3.1111191: MW. demmemmmybo ”We WumofﬂnvolmofPugnmuMRumch harm-win. ‘nutitlo will pmhoblybc W'Mtthuummd-ﬁniu. anodimwillpmbablyboP.B.w1eymdM.ﬂm<. wwmmitwmlyinus'l. Simunly yours, rm). m Pink, of Wear Payctdmy � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Himwich, Harold E. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-334 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c5c67e432a1b5d9e5f50930ce445795c.pdf e5215171ea58ce8ce9107d6b6d91e1f7 PDF Text Text Juan 6 , 1966 Baltimore, mum 21201 Dam A1, Implmdtohawthaoppwtmitympartiaipauin WWWWMtM. MIWWIM mammamurmpmmwmrm inrngpimtuinmﬂngmmmmingum M ' ' o ' mummmmmmmmnm amprdnt? Sincerely yours, Firm. PM). m Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Kurland, Albert Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-335 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c536cef8c2c7b40ae4a3131f05f79766.pdf 7bc83a80f009c3d89480d57516abf8d3 PDF Text Text Jtme 6, 1966 Mr. M. J. Feeney American Airlines District Sales Branch an Nwth 10th Street St. Innis, Missouri ‘ Dear Mr. Foamy: For the past few years I have been traveling regularly betweenﬂew‘fozkandSt. Lmiaandrecentlywiththemffic eonditimeinNewYorkbemmatﬂmym,begmmand Overthenextmany mtobedependentonWiaﬂ‘miml. and my weekly biweekly mantra, I will amtinue or tripe to ﬁmNewYmm Immitingtomqmtymmmidemtion ofenmberehipeardinymmﬂanirel'ecmb. Mlimieatedtoymmmetary, Iwillbemvingmy family to New York in late June but will continue my relatim~ so that my present weekly scindule will probably mama-e. can rue. Incidentally, I of your 5M5 Many flight was from very pleased to be an the inauguration New York to St. Louis on May 27. thanks. Sineerely ycmra , Fink, M.D. Professor of Psychiatry Mex )1?sz � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Feeney, M.J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-336 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/5715d23685e9c4c6a6ede8f4405bf72b.pdf 29d0bc80cd7ee7519afbf88951c0a1e7 PDF Text Text June 6, 1966 metary mammmorwmtwmmungm 9.0.3::«4 Mr.JolmA.Haﬂoy W www.mz Jeffm City. 65131 Effwtinm 30.1w111m1mmimmdmim inmStateofrﬁom-i.u1unlaatingmyotﬂmw NwYork. Mfmmmwﬂlbn: Wdhydﬁtm Mkaﬁ-dimmlm mmnmmst. ﬂaw York. New York 10029 Simly yum, Max Pink, PhD. MW of WW � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Hailey, John A. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-337 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/0dde53adb5eef6f0c6b7f22c837c92fc.pdf 0ef7cd1c3163eb2008c5f534ee65fa21 PDF Text Text Juno 3, 1966 o. (bl. mm I1, mImam: m01mm Halt}: mm, Mind “‘0 W 3m ~ 5 2001“ W Wmhmmofmhm. mmnmm. Dun-mm. MWmth-“Clmmszwuofmiwimm :wmuummmmmmamorm Ithimtitm Sincerely yours, Mm: Firm, 14.1). Professor of Psychiatry mzkp - unprw ﬁn‘ww‘wr- . . � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Cole, Johnathan O. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-338 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/eef4ca4dd91e93c539a27ffdd1533fa6.pdf 031bb9da36382373a83bf41a3657bfbd PDF Text Text ._._.__ m—w-m w V W.-.” Jun 6, -- 1966 my. w...-.h Vin—m Dr. V. Vim Stan lbcpim mm mm, Bar lb. “qr-memvw" —, m. ‘wrn-Irv-‘ﬁ'ﬂ‘r ‘ ﬂaw York Vim-k: 113W Implouodwmivommmipt. mmwudbyw.w1~ym1villwﬁampymhm. Thanh-Wtwﬂlappm,llmpo,wiﬂ1tmmmm. Ifthwciswpmblmwimp‘mnmﬂm,1wﬂlgetin MUi‘thyuh Similar yams, Pink, H.D. mem of Wm Max xx. r v» ”our znaagr V’rrur- p LVIKI'Y’JM waxy/W14, wmrwmnwzw»-a : ’ r'r—urznw � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Vitek, V. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-339 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/808bb06f42db04bbc47585a73dd4febc.pdf 84e1db7bc888e30d56d368ec65a72cc1 PDF Text Text June 7. 1966 Donna, Whamafﬂnminiodhbmmm mxmmyw.1tuammmm WWMM. win-tram. mum, Wm of Wm Max Firm, PM). � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Hollister, Leo Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-340 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8a30475c95253617a6fcd0f20dd4e4c7.pdf 416fa20cd6c7edf5f75b03896e64d8ba PDF Text Text June 7, 1966 Dr. Jam H. Talbott, PM). Editor, Jamaal of tho Andean Medical Assn. 535 N. Bourbon} St. Chicago. Illinois 60610 Dear Dr. Talbott: Enclosed are three copies of a Import for your consideration problm of the simifioam of in the evaluation of psychotropic drugs was brought to our for the Jomm. tats 1mm 'Iha attmtimbytmmueofipmmm. Comittoc on Clinical Drug Evaluation Mamofme of the Mariam Institutes ofﬂlnmﬂulth, Ibomamofﬂmamompmblmﬂnttm early clinical drug avalmtim units foot in testing new oowounds in mm psychotic populations. This study is an effort to clarify tho qmstim of the variability of laboratory test abut-various. OrigixmlsofﬂwfigmsmmlooeduﬂIbeliowthe citations follow the 'Ihmk you Jami style. for your oonsidemtim. Sixmmly ma, Pink, mp. Professor of Psychiatry Max PEEK}: � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Talbott, John H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-341 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/a43d456c910f1775bdb1767541013dff.pdf 2f73e40ff8ecee35890f91e68b6bcd04 PDF Text Text Juno 7, 1966 Mr. P. H. Vuy-jc, om Int-national Cam-a anartmnt Dar m. Vuynjc: Inwriting with mguﬂtoSymponimG "Antioho Dnmnndﬁninhmtioninhimlomdm.” uliohinpnrtef Iuinneuiprtofimtmetiom \ memmnotmtm. mm.00hugnrdingﬁnwheiuimefmiptsfer Mientiminﬂnpmdingsofﬁnm. Mmhnwimiiutedtok.¢olc.ﬁnfu11tnxtofﬁnvnrious Wainbnmududinnsmtovelm. whammtod, ‘m,mtmmdmmwnwntmtby the in the Emma W! b. WulmeNMsturivein W Rounding; md willbomilndmyw included these yamhmdnbythnmdome. Imwitingtolr.ﬂzi1ipm~ndleymaumitmnbnmt dirwtlyteymferhisomuibutim. Imntﬂutﬂxiswinmtdnlnyﬁnpublientimofﬂn volun,andlookfommmnsnintingyouinomywnythatwe mmﬂutﬁnmnbntmtsmyappnnrinthefimlpmenodingn. Sincerely yours. Din-x Fink, Md). mensm of Efﬁgy cc: Dr. P. 8. Bradley Wm � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Vuysje, P. H. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-342 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/6a3c63e30fb88ea50403085871275891.pdf 796f94a398a11bfeaed28f84969397d1 PDF Text Text mw~v Var—v .m. ”M'nv.“ 'w-ww-rxwr-w :— a. .. v: w‘ 1. 'lvr-wh“-=~ ,. ,v‘_‘. ,v. 1w m: wr'ﬂl‘. “. r"... ._-,—-wv—«:~v..v Jum 13, Sr. Gm, Institute for Payehomtic Dr. Roy R. and Psychiatric AW 29th Strut am E1113 Chicago, Illinois 60616 Dear Dr. 1966 W Grim: Hyumhtumdlmpmaedmmitthemclosed Mjecta" mpm"mmodmmnmmmuminpmmm tho Mauvu. for m Wham“ in for your midnmtim ﬂumﬁmtimoflﬁbammmudmmiswinm Wvumingmwtfwmmtwﬂﬁsmiwofw WWEMWoftmmofwbua Win agent in the mmnt of lmg~m psynhoties. Thank you for year midnm’cim. Sinoemly yams, Hm: Fink, H.D. at Psychiatry Harm � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Grinker Sr., Roy R. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-344 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8e2cee980a01fe1039abb509b347c7a5.pdf a55308022590279e722525f0f946db1c PDF Text Text Jme 6, 1%6 Mr. M. J. Foamy Amman Airlims Salas Wm}: 01mm ‘31]. North 10th Street St. Louis, Miami Dear Mr. Feeney: Fmﬂnpustfwymlravebemmvelingmgularly mmmzkandsmlmismrmtlywiththemffic mitminﬁwYorkbwmmtmym.begmmm mtobedepandmtmmnrdia'rmmu. thnnextmany fmnNawYmkaamwitingtowqmtmmidmﬁon mths,Iwinomtinmwmklyorbiweeklytripstoand ofamhipcaMianHiml'aClub. Aalimiontedtommtm,1willbemvingw funny to New York in late J1me but will conﬁrm: my relatim~ will probably shiphem, aoﬂntmypresmt weakly We mtinm . Imidantally,1wasmyplmedtobamthuinaugumtim ofyowSWSﬂightmewYorktoSt.louismMay27. Many thanks. Sincerely Max yam, Pink, NJ). Profeaam‘ of Payd'tiatx‘y � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Feeney, M.J. Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-345 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/62de2b1576c1af022dd464c7677c561e.pdf 589a1c0401ccb33e6b007b6b032b05d0 PDF Text Text New 28, 1965 Printing Co. . Inc. Ward 539 P. 0. Ben: mm)... Wage 37202 Guam: WhaWMrfwtwa—hwmdnpdnts WtwAmmofwmmmVolmmfbspﬂm” for the article ”Souiwdxological Asp-eta of Psydﬂatric which 5.8 the official carder from the University for the “prints ﬂuently. mud Shandy you“. Hut Pink. NJ). Professor of Psychiatry . w- w—wv— .w- � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Baird-Ward Printing Co., Inc Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-347 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/c3d7fa2e9fdc9dc4c0a1b9676c4b80b6.pdf a221b0c1002ae873be7ba6768fa1e8cd PDF Text Text May 25, 1966 Dr. Barbara Fish Associate mecaaor of Paymiatry of Psychiatry and Nemlogy W1: New 556 York miwmity First Am» m1 of New ﬂaw You-.2, New York 10018 MW, Implmaétomyouaaopyofmemportmmyw Amw~WmnimhasbmWadby maJmmnMwm mdmwmemmmw withinﬁmmxtfwmmma. mashed. .‘g-w ~ c'rJrgu . 'VVY: «warn Thiambeanmomlovaafaﬁmwit 'wmmat pleasure to present this material this your. hm collected ' . ~ v for“ mtammmmmpomu‘ic mmmmhem imingly {unwind width wua- w V pmruaim has me' .w-wr 17';:- v._ .mwm mm. I think it is an ”My been forgotten. 310mm: in ayatam and “Many in W Want ”mode. mm! amtylcholim has “a: mm 1:13 W Ilookfmwmtoaaamgymagaininﬁmhrk. mgaIdS“ . Mybast y.- Sinmly yam , wzm:amﬁ.$mr . Max . vu— «w .w .,._ w. . ['“Qﬁ'fﬂ' Finlc, £1.13. Professor of Psychiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Fish, Barbara Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-348 Date A point or period of time associated with an event in the lifecycle of the resource 1996 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8e02fe88b841e22dd416d85fc36aece8.pdf 0f2b4e9f9b3fec52292af3b21174296b PDF Text Text ~.. ...... «v.11 , ﬂ” ”7,,“ "Wm”... ~-..r.7..,~-4n- \" --~~\ -~ " - ‘ MW 9 , 1966 DmSMpixohaspmpamdﬁnfoumingapooﬂimim! unmadmwlyaeswhiehmofmmmmmm Wiley. havmtutmsmmihbhtomm WWmluimmimofanmImet-u. I hope the» m halpful. Simmly yours, ﬂax Pink, 14.1). MW of Psydxiatry � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Klearman, Barney Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-350 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/8d93fff7413a6ee0d307897ac203f94c.pdf 90beacfffcf9fb458ffb9d18d28793cd PDF Text Text June 13, 1966 mm. MWMWMWW newuhhmm 990131:le Albmy. Haircut Mair: Ihuwmlymtmudmﬂwmmmwitingm mmedemmlemt memwmnmumm Mada-om. Wynn. Simly yum, W Mu Fink, 14.1). of POM � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Special Programs Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-351 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence http://exhibits.library.stonybrook.edu/mfp/files/original/92860d9ef0e4ce45db1150f37e81b8fb.pdf e57ccf65c2a4fb6d046aec345ed6a138 PDF Text Text June 13, 1966 v wxuvw “ma—m ‘Ur-Im mwrn—xsvv: fr. mm mm W m mm, of Psychiatry for tho Health Sawiau LCM Lon :uwn-w-n—v California 9022!; Dank-1th. vm" ~vw-v minn‘vﬂwwr-Wwemlw Whamllomwimﬂmwithmmmﬁupmblm ofmlimtiamothsbddnhmintuutym. Yam-mm bunnduﬁnitivo.ﬁntwommmﬁmmmlybeamnm, “Waitmmmmumwminmmms inmpuydnﬁcmbjm. Wmmmmmﬁmvu forﬁnirmiduutim farpublimtim. thank you . . far yum intamst. ‘ Slimly Hue Pink, yours, 24.x). humour of Psychiatry Mmkp .- pun— wax � Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence Text A resource consisting primarily of words for reading. Examples include books, letters, dissertations, poems, newspapers, articles, archives of mailing lists. Note that facsimiles or images of texts are still of the genre Text. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Correspondence to: Dittman, Keith Type The nature or genre of the resource Text Identifier An unambiguous reference to the resource within a given context mfp-05-00-020-6-352 Date A point or period of time associated with an event in the lifecycle of the resource 1966 Creator An entity primarily responsible for making the resource <a title="Fink, Max, 1923-" href="http://id.loc.gov/authorities/names/n79039548" target="_blank">Fink, Max, 1923-</a> Subject The topic of the resource Correspondence -- Correspondence Relation A related resource The Max Fink Collection Description An account of the resource Rights Information about rights held in and over the resource <a title="IN COPYRIGHT - EDUCATIONAL USE PERMITTED" href="http://rightsstatements.org/vocab/InC-EDU/1.0/" target="_blank">IN COPYRIGHT - EDUCATIONAL USE PERMITTED</a> Source A related resource from which the described resource is derived Special Collections and University Archives, University Libraries. Stony Brook University Libraries (State University of New York). Language A language of the resource en-US Format The file format, physical medium, or dimensions of the resource application/pdf Publisher An entity responsible for making the resource available Contributor An entity responsible for making contributions to the resource Correspondence